Glyma11g29920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g29920

Feature Type:	gene_model
Chromosome:	Gm11
Start:	30823384
stop:	30827737
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g29920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G05340	AT	Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein \| chr5:1579142-1580819 REVERSE LENGTH=324	SoyBase	E_val: 2.00E-121	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004601	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxidase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PF00141	PFAM	Peroxidase	JGI		ISS
UniRef100_I1LLU8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLU8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q40372	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Medicago truncatula RepID=Q40372_MEDTR	SoyBase	E_val: 2.00E-177	ISS

Expression Patterns of Glyma11g29920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g29920

Paralog	Evidence	Comments
Glyma18g06220	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g29920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g161800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g29920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g29920

Limit To All Plant Sequences

>Glyma11g29920.1   sequence type=CDS   gene model=Glyma11g29920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTAATATCCAAACTCTGCTTGTGCTTGTTCTGGCTACATTGGCCATATTTATGATCCCTTCCAATGCACAACTTACTCCTAATTTCTATAAGAAAGTTTGTCCCCAAGCATTGCCAATCATAAGGTCTGTCGTTCACCGTGAAATCATTCGTGAACGACGCATTGGAGCCTCCTTGCTACGTTTGCATTTCCATGACTGCTTTGTTAATGGTTGTGATGGATCAGTTCTGCTGGATGATACGCGCAACTTCACTGGCGAGAAAACAGCCCTACCTAATCTGAATTCAATAAGAGGTTTGGAAGTGGTTGATGAGATTAAGGAAGCTGTTGACAAAGCTTGCAAACGCCCTGTGGTATCATGTGCTGATATCTTAGCTACAGCTGCTCGTGATTCTGTGGCCATATTAGGTGGTCCACACCTACGGTACTCAGTATTACTAGGCAGAAGAGACGCAAGAACCGCAAGCAAGGATGCTGCAAACGCCAATCTCCCTCCTCCATTTTTCAGCTTCTCACAACTTCTCTCCAACTTCAAGTTTCACGGATTAGACCTCAAAGACTTGGTGGCACTTTCTGGAGGCCACACATTAGGGTTTGCAAGGTGCACTACCTTCAGAGACCGCATCTACAACGACACCAACATAAATCCTACCTTTGCAGCCTCTTTGCGCAAAACATGCCCTAGAGTTGGCGCTGGCAACAACTTGGCACCGTTGGATCCAACTCCTGCAACGGTTGACACTTCTTACTTCAAAGAATTGCTGTGCAAAAAGGGTCTTCTTCACTCTGATCAAGAACTCTACAAGGGAAATGGCAGTGAAAGTGACAAGTTGGTGGAGCTTTATAGCAGAAACCCTTTTGCATTTGCTAGAGATTTCAAGGCTTCTATGATCAAGATGGGTAACATGAAGCCTCTCACTGGGAACAAGGGAGAGATCAGACGCAACTGCAGAAGGGTTAATAATTAA

Predicted protein sequences of Glyma11g29920

Limit To All Plant Sequences

>Glyma11g29920.1   sequence type=predicted peptide   gene model=Glyma11g29920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNIQTLLVLVLATLAIFMIPSNAQLTPNFYKKVCPQALPIIRSVVHREIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTRNFTGEKTALPNLNSIRGLEVVDEIKEAVDKACKRPVVSCADILATAARDSVAILGGPHLRYSVLLGRRDARTASKDAANANLPPPFFSFSQLLSNFKFHGLDLKDLVALSGGHTLGFARCTTFRDRIYNDTNINPTFAASLRKTCPRVGAGNNLAPLDPTPATVDTSYFKELLCKKGLLHSDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVNN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain