SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g29842

Feature Type:gene_model
Chromosome:Gm11
Start:30739029
stop:30741444
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g29842
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G06950AT Annotation by Michelle Graham. TAIR10: translocon at the inner envelope membrane of chloroplasts 110 | chr1:2130303-2135563 REVERSE LENGTH=1016 SoyBaseE_val: 3.00E-53ISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0045037GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031897GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Tic complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_G5DW22UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast inner envelope protein (Fragment) n=1 Tax=Silene latifolia RepID=G5DW22_SILLA SoyBaseE_val: 3.00E-52ISS
UniRef100_I1MZT5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZT5_SOYBN SoyBaseE_val: 5.00E-63ISS

Expression Patterns of Glyma11g29842
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g29842 not represented in the dataset
Glyma11g29842 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g29842
ParalogEvidenceComments
Glyma18g06260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g29842 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g162400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g29842
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g29842
>Glyma11g29842.1   sequence type=CDS   gene model=Glyma11g29842   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCTGTGTACCTCAACAGACCATTGATGCAGCTCACTCCGATATCTGTGGCAGTTGGTTTGAAAAGGTTGTCAAGGATACGATTGCATCAGGGGTTGATGGATATGGTGCGGATATCTGGAAATCAGTAAGAAAAGCAGCACATGGCTTGCGACTAACCAGGGATACTGCTATGTCTATTGCAAGCAAGACCATAAGGAAAATATTTATTAATTTCATACAACGTGCACGAGCAGCTGGGAATCATAAAGAATCTGCAAAAGAACTAAAGAAAATGATAGCTTTCAACACCTTGGTTGTGACTGAGTTGGTGAATGGCATTAAAGAGGAGTCAGATGATGAGTCAACTGAAGAACCTGGAAAGGAGGGTGATACAAACTGA
Predicted protein sequences of Glyma11g29842
>Glyma11g29842.1   sequence type=predicted peptide   gene model=Glyma11g29842   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLCVPQQTIDAAHSDICGSWFEKVVKDTIASGVDGYGADIWKSVRKAAHGLRLTRDTAMSIASKTIRKIFINFIQRARAAGNHKESAKELKKMIAFNTLVVTELVNGIKEESDDESTEEPGKEGDTN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo