Glyma11g29750 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g29750

Feature Type:	gene_model
Chromosome:	Gm11
Start:	30536361
stop:	30537572
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g29750

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G10985	AT	Annotation by Michelle Graham. TAIR10: senescence associated gene 20 \| chr3:3442776-3443108 FORWARD LENGTH=110	SoyBase	E_val: 3.00E-20	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07107	PFAM	Wound-induced protein WI12	JGI		ISS
UniRef100_G7KFI5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Wound-induced protein n=1 Tax=Medicago truncatula RepID=G7KFI5_MEDTR	SoyBase	E_val: 1.00E-54	ISS
UniRef100_I1LLT8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LLT8_SOYBN	SoyBase	E_val: 6.00E-102	ISS

Expression Patterns of Glyma11g29750

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g29750

Paralog	Evidence	Comments
Glyma18g06340	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g29750 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g163100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g29750

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g29750

Limit To All Plant Sequences

>Glyma11g29750.1   sequence type=CDS   gene model=Glyma11g29750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGAATATGTGGAACACAACACGAGAGTGGTCACGGAATTATACAAAGCCCTAACCTCTAAAGACCCCGAAACGCTTCATGGGATTGTGGCCCAAGACTTGGAGTGGTGGTTCCACGGCCCATCATGCCATCGGCACCACTTGGTCCCCTGGCTCACGGGCTCCTCACCCTCCTCAAAGGCTTTGGTTCCGCAACATGTGGTGGGCTTTGGGCCATTGGTTATTGCTGAAGGGTTTGATGAGGCCCATTTGGTGTGGTGGGTGCATGCATGGACCATCAGAACTTCTGATGGGCTCATAACCCAGGTCAAAGAGTATGTGAACACATCCGTTTCCGTGACTCGTTTATCACAAATGCTTCCAAATGCTTCCAATTGTCAATGCATTTGGCAGAGTAGGCTTTGTGATGAATCAGTGCCTGGACTTGTTCTGGCAATCTAA

Predicted protein sequences of Glyma11g29750

Limit To All Plant Sequences

>Glyma11g29750.1   sequence type=predicted peptide   gene model=Glyma11g29750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPEYVEHNTRVVTELYKALTSKDPETLHGIVAQDLEWWFHGPSCHRHHLVPWLTGSSPSSKALVPQHVVGFGPLVIAEGFDEAHLVWWVHAWTIRTSDGLITQVKEYVNTSVSVTRLSQMLPNASNCQCIWQSRLCDESVPGLVLAI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain