|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G54750 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; Has 145 Blast hits to 145 proteins in 60 species: Archae - 0; Bacteria - 0; Metazoa - 99; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr3:20264833-20268416 REVERSE LENGTH=589 | SoyBase | E_val: 2.00E-20 | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_I1JQC5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQC5_SOYBN | SoyBase | E_val: 1.00E-31 | ISS |
| UniRef100_Q8GXI8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AT3G54750 protein n=1 Tax=Arabidopsis thaliana RepID=Q8GXI8_ARATH | SoyBase | E_val: 9.00E-18 | ISS |
|
Glyma11g29681 not represented in the dataset |
Glyma11g29681 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g163700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g29681.1 sequence type=CDS gene model=Glyma11g29681 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGGCCGAGCACGGTAGCGTGAGCAACGATAGTGATGGCGACTACGACGATGATGATGAATTGGACGAGGTGTTCAGCTTCGGGACGTCGTTTGTGGACGTTGTCGCTGCCGATTGGCTCTCGCAGAAGGTGTCGAGGGGCGTGCATATTAGGTCATTCTCTGATGTTGATAATAGCCCAGCATCTTTGCTGGCTGTTAGTGGCAACAACAATGTACATGCTTTATATGACTTTTTACTAAATTACAGATTTCTGTTGACCTCACTGTCTAGTGTGGACGTACCTGTCTTATGCTCTCCTGTGCCATTTCAAAATTCTGCTTTGTCTTCTCCTGACGTATGTCCTTGGCTTCATTTTCTTTCCATTTAA
>Glyma11g29681.1 sequence type=predicted peptide gene model=Glyma11g29681 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVAEHGSVSNDSDGDYDDDDELDEVFSFGTSFVDVVAADWLSQKVSRGVHIRSFSDVDNSPASLLAVSGNNNVHALYDFLLNYRFLLTSLSSVDVPVLCSPVPFQNSALSSPDVCPWLHFLSI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||