SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g29520

Feature Type:gene_model
Chromosome:Gm11
Start:30241576
stop:30242852
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g29520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30200AT Annotation by Michelle Graham. TAIR10: catalytics;transferases;[acyl-carrier-protein] S-malonyltransferases;binding | chr2:12883162-12885482 REVERSE LENGTH=393 SoyBaseE_val: 5.00E-112ISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004314GO-mf Annotation by Michelle Graham. GO Molecular Function: [acyl-carrier-protein] S-malonyltransferase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
PTHR10982Panther MALONYL COENZYME A-ACYL CARRIER PROTEIN TRANSACYLASE-RELATED JGI ISS
PF00698PFAM Acyl transferase domain JGI ISS
UniRef100_Q2VA66UniRef Annotation by Michelle Graham. Most informative UniRef hit: Malonyltransferase n=1 Tax=Glycine max RepID=Q2VA66_SOYBN SoyBaseE_val: 2.00E-125ISS
UniRef100_UPI000233CB4AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CB4A related cluster n=1 Tax=unknown RepID=UPI000233CB4A SoyBaseE_val: 3.00E-131ISS

Expression Patterns of Glyma11g29520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g29520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma11g29520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g29520
>Glyma11g29520.2   sequence type=CDS   gene model=Glyma11g29520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTGAAGATGGACTCAAGTTGGTCAAACTGAGGGGTGAGGCCATGCAGGATGCCGCCAATGCTGCTAAAAGTGCTATGGTTAGTGTGATAGGACTGGACTCAGAGAAGGTCCAACAATTGTGTGATGCAGCCAATCAGGAAGTTCCTGAAGCTGAGAAGGTTCAGATTGCCAATTACCTGTGCCCAGGAAACTATGCTGTCTCTGGGGGATTAAAAGGAGTAGAAGTGCTGGAATCCAAGGCAAAGTCTTTCAAGGCTCGAATGACGGTGCACCTAGCTGTTGCTGGTGCTTTCCACACTAGTTTTATGAAACCAGCTGTGTCAAGGTTGGAAGCAGCATTGGCAACAACAGAAATCAGAACCCCAAGAATACCAGTCATCTCCAATGTGAATGCACAGCCACATACAGATCCTGACTCAATAAAGAAGATATTGGCATGCCAGGTTACCTCACCTGTTCAATGGGAAACAACAGTGCAGACTCTTCTAACCAAGGGTCTGAAGAAAAGCTATGAACTCGGACCCGGAAAGGTTATTGCTGGAATCATCAAAAGAACGGACAAA
Predicted protein sequences of Glyma11g29520
>Glyma11g29520.2   sequence type=predicted peptide   gene model=Glyma11g29520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FEDGLKLVKLRGEAMQDAANAAKSAMVSVIGLDSEKVQQLCDAANQEVPEAEKVQIANYLCPGNYAVSGGLKGVEVLESKAKSFKARMTVHLAVAGAFHTSFMKPAVSRLEAALATTEIRTPRIPVISNVNAQPHTDPDSIKKILACQVTSPVQWETTVQTLLTKGLKKSYELGPGKVIAGIIKRTDK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo