SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g29450

Feature Type:gene_model
Chromosome:Gm11
Start:30118388
stop:30119989
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g29450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30130AT Annotation by Michelle Graham. TAIR10: Lateral organ boundaries (LOB) domain family protein | chr2:12868740-12869684 FORWARD LENGTH=193 SoyBaseE_val: 3.00E-76ISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010016GO-bp Annotation by Michelle Graham. GO Biological Process: shoot morphogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF03195PFAM Protein of unknown function DUF260 JGI ISS
UniRef100_G7J0R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J0R0_MEDTR SoyBaseE_val: 4.00E-89ISS
UniRef100_I1LLS0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLS0_SOYBN SoyBaseE_val: 3.00E-124ISS

Expression Patterns of Glyma11g29450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g29450
ParalogEvidenceComments
Glyma18g06530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g29450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g164800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g29450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g29450
>Glyma11g29450.1   sequence type=CDS   gene model=Glyma11g29450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGGTACCTCACCTTGTGCTTCTTGCAAGTTGTTGAGACGCCGTTGCTCCAAAGACTGCATCTTTGCTCCTTACTTTCCTTCTGACGACCCTCGCAAGTTTTCCATTGTGCATAAGGTCTTTGGTGCCAGCAATATCAGCAAAATGCTGCAGGAGCTTCCAATTCATCAAAGAGCAGATGCTGTGAGTAGTTTAGTTTATGAGGCAAATGCAAGAGTTAGAGACCCTGTGTATGGATGTGTTGGAGCCATATCATACCTACAAAACCAAGTTTCACAATTGCAAATGCAGCTTGCAGTGGCTCAGACAGAGATTTTATGCATCCAGATGCAGCAACAAGAGCCTACCTTAGCCACACAATTAGTAGACCAAGATGACAAATCAATGCTCCTATCTGTAAACAATAACTATGAAATGCTTCCTCAGTTTCTTAAGTTTCCTTCATCCTCTTCCTCATCTTCCAATGTATTCCAAGACCCTCATGAGCCTCTTAAGAGAGAGTCTTTTTGGACTTGA
Predicted protein sequences of Glyma11g29450
>Glyma11g29450.1   sequence type=predicted peptide   gene model=Glyma11g29450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGTSPCASCKLLRRRCSKDCIFAPYFPSDDPRKFSIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQTEILCIQMQQQEPTLATQLVDQDDKSMLLSVNNNYEMLPQFLKFPSSSSSSSNVFQDPHEPLKRESFWT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo