Report for Sequence Feature Glyma11g29280
Feature Type: gene_model
Chromosome: Gm11
Start: 29836854
stop: 29842391
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g29280
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G58530 AT
Annotation by Michelle Graham. TAIR10: Glutaredoxin family protein | chr5:23660428-23661249 FORWARD LENGTH=273
SoyBase E_val: 3.00E-56 ISS
GO:0045454 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis
SoyBase N/A ISS
GO:0048653 GO-bp
Annotation by Michelle Graham. GO Biological Process: anther development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0015035 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity
SoyBase N/A ISS
KOG1752
KOG
Glutaredoxin and related proteins
JGI ISS
PTHR10168 Panther
GLUTAREDOXIN
JGI ISS
PTHR10168:SF44 Panther
GLUTAREDOXIN DOMAIN-CONTAINING CYSTEINE-RICH PROTE
JGI ISS
PF00462 PFAM
Glutaredoxin
JGI ISS
UniRef100_D7MQE6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MQE6_ARALL
SoyBase E_val: 3.00E-53 ISS
UniRef100_I1LLQ6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLQ6_SOYBN
SoyBase E_val: 9.00E-164 ISS
Expression Patterns of Glyma11g29280
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma11g29280
Paralog Evidence Comments
Glyma18g06640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma11g29280 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g166300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g29280
Coding sequences of Glyma11g29280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g29280.1 sequence type=CDS gene model=Glyma11g29280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGCAACCTTGGAACAAACCTCGTTCTTCTCCATTCTCATGTTCTTCCTTCAAAGACATTCAAACCCTCTTCTTAGATGAACCCACCACCACCAAACCCAAACCCTCTATCTTCCACCGAGTCACACTCGCCAACTCGCTCCTCCGCGCCTGGTCAACTAACCCCAAAATCTCCTCACGCGCCCACGACGAAGCCCCACGCGCCGCCCAACCACACCCTCCGCCGTCCATTCTCCGCTCGGAGCAGCGCGTGGTGGTCTACTTCACGAGCCTGCGCGTGGTCCGCGCCACGTTCGAGGACTGCAAAACGGTGCGTTCCATCTTGCGCGGGTTCCGCGTCGCGCTGGACGAGCGCGACGTGTCCATGGACTCGGGTTTCCTCTCGGAGCTCCGTCGGGTAACGGGTCACAAATCCGGTTTGACCCTGCCACGTGTCTTCATTAACGGAAGGTACGTCGGTGGGGCCGAGGAGCTGAGGTGGCTGCACGAGAGTGGCGAGCTCAAGAAGCTTCTCGAGGGCTTGCCCGCAGTGGATTCGCACCTCCGTGTGTGCCACGTGTGCGACGATCATAGGTTCGTGCTGTGCGGGGAGTGTTCCGGTGCGCGCAAGGTGTACGCGGAGAAAGGTGGGTTCAAGACGTGTACGGCTTGCAACGAGAGTGGCTTGATCAGATAA
Predicted protein sequences of Glyma11g29280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g29280.1 sequence type=predicted peptide gene model=Glyma11g29280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLQPWNKPRSSPFSCSSFKDIQTLFLDEPTTTKPKPSIFHRVTLANSLLRAWSTNPKISSRAHDEAPRAAQPHPPPSILRSEQRVVVYFTSLRVVRATFEDCKTVRSILRGFRVALDERDVSMDSGFLSELRRVTGHKSGLTLPRVFINGRYVGGAEELRWLHESGELKKLLEGLPAVDSHLRVCHVCDDHRFVLCGECSGARKVYAEKGGFKTCTACNESGLIR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
