SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g28770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g28770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g28770

Feature Type:gene_model
Chromosome:Gm11
Start:29296797
stop:29297598
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G45000AT Annotation by Michelle Graham. TAIR10: AAA-type ATPase family protein | chr1:17009220-17011607 FORWARD LENGTH=335 SoyBaseE_val: 6.00E-72ISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR23073Panther 26S PROTEASE REGULATORY SUBUNIT JGI ISS
PTHR23073:SF10Panther 26S PROTEASE REGULATORY SUBUNIT S10B JGI ISS
PF00004PFAM ATPase family associated with various cellular activities (AAA) JGI ISS
UniRef100_B9R7Z7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit S10b, putative n=2 Tax=fabids RepID=B9R7Z7_RICCO SoyBaseE_val: 3.00E-71ISS
UniRef100_I1LLP7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LLP7_SOYBN SoyBaseE_val: 4.00E-95ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g28770 not represented in the dataset

Glyma11g28770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g28770.1   sequence type=CDS   gene model=Glyma11g28770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATTCAACTGTTAGTGGCTTATCTGATCAAATCAGGGAATTAAGGGAGTCAATTGAACTACCTCTGATGAATCCTGAGCTCTTTCTTCAATTTGGAATTAAACCTCCAAAGGGTGTTCTCCTTTACGGGCCTCCTGGTACTGGTAAAACATTTCTTCTTCGTTGTAAAATTGACAAGTACATTGTCAATTTTATGCTAACTTCCCTTTATTCTGATTACATTGGAGAAAGTGCCAGGTTAATCAGAGAGATGTTTGGTTATGCACGTGATCACCAGTCGTGCATCATTTTTATGGATGAGATTGATGCCATTGGAGGTCTCCGTTTCTGTGAGGGAACAAGTGCAGATCGTGAGATTCAGAGAATGCTAATGGAGCTGCTTAATCAACTTGATGGATTTGATCAACTTGGAAAG

>Glyma11g28770.1   sequence type=predicted peptide   gene model=Glyma11g28770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YSTVSGLSDQIRELRESIELPLMNPELFLQFGIKPPKGVLLYGPPGTGKTFLLRCKIDKYIVNFMLTSLYSDYIGESARLIREMFGYARDHQSCIIFMDEIDAIGGLRFCEGTSADREIQRMLMELLNQLDGFDQLGK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo