Glyma11g28770 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g28770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g28770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g28770

Feature Type:	gene_model
Chromosome:	Gm11
Start:	29296797
stop:	29297598
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g28770

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G45000	AT	Annotation by Michelle Graham. TAIR10: AAA-type ATPase family protein \| chr1:17009220-17011607 FORWARD LENGTH=335	SoyBase	E_val: 6.00E-72	ISS
GO:0030163	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein catabolic process	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
PTHR23073	Panther	26S PROTEASE REGULATORY SUBUNIT	JGI		ISS
PTHR23073:SF10	Panther	26S PROTEASE REGULATORY SUBUNIT S10B	JGI		ISS
PF00004	PFAM	ATPase family associated with various cellular activities (AAA)	JGI		ISS
UniRef100_B9R7Z7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit S10b, putative n=2 Tax=fabids RepID=B9R7Z7_RICCO	SoyBase	E_val: 3.00E-71	ISS
UniRef100_I1LLP7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LLP7_SOYBN	SoyBase	E_val: 4.00E-95	ISS

Expression Patterns of Glyma11g28770

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g28770 not represented in the dataset	Glyma11g28770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g28770 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma11g28770

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g28770

Limit To All Plant Sequences

>Glyma11g28770.1   sequence type=CDS   gene model=Glyma11g28770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATTCAACTGTTAGTGGCTTATCTGATCAAATCAGGGAATTAAGGGAGTCAATTGAACTACCTCTGATGAATCCTGAGCTCTTTCTTCAATTTGGAATTAAACCTCCAAAGGGTGTTCTCCTTTACGGGCCTCCTGGTACTGGTAAAACATTTCTTCTTCGTTGTAAAATTGACAAGTACATTGTCAATTTTATGCTAACTTCCCTTTATTCTGATTACATTGGAGAAAGTGCCAGGTTAATCAGAGAGATGTTTGGTTATGCACGTGATCACCAGTCGTGCATCATTTTTATGGATGAGATTGATGCCATTGGAGGTCTCCGTTTCTGTGAGGGAACAAGTGCAGATCGTGAGATTCAGAGAATGCTAATGGAGCTGCTTAATCAACTTGATGGATTTGATCAACTTGGAAAG

Predicted protein sequences of Glyma11g28770

Limit To All Plant Sequences

>Glyma11g28770.1   sequence type=predicted peptide   gene model=Glyma11g28770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YSTVSGLSDQIRELRESIELPLMNPELFLQFGIKPPKGVLLYGPPGTGKTFLLRCKIDKYIVNFMLTSLYSDYIGESARLIREMFGYARDHQSCIIFMDEIDAIGGLRFCEGTSADREIQRMLMELLNQLDGFDQLGK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain