SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g28430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g28430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g28430

Feature Type:gene_model
Chromosome:Gm11
Start:28566386
stop:28566679
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g28430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43970AT Annotation by Michelle Graham. TAIR10: translocase of outer membrane 22-V | chr5:17692888-17693187 FORWARD LENGTH=99 SoyBaseE_val: 3.00E-30ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005742GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane translocase complex SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
UniRef100_I1LLP4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LLP4_SOYBN SoyBaseE_val: 3.00E-61ISS
UniRef100_Q9FNC9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM22 homolog 2 n=1 Tax=Arabidopsis thaliana RepID=TO222_ARATH SoyBaseE_val: 2.00E-27ISS

Expression Patterns of Glyma11g28430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g28430 not represented in the dataset
Glyma11g28430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g28430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g168500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g28430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g28430
>Glyma11g28430.1   sequence type=CDS   gene model=Glyma11g28430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCCGAAGAGGTGGAGTCTCACTCCCAGACAGACCTAGCAACAACTCAAGCTCCGTCCTCACGAATATCTCATGCTCCTCCATCGTCACCCGCGGCAAGGAAGCCGCCGGCGACGCTGCATTTGTCACCAAGAAGCTCCTCCGCAACACCGGCAAGGTCACGTGGATCATCGACACCACCTTCCTCTTCCTCGTTGTTCCTCTCATTGTCAAGATGGACCGCGAGCAGCAACTCAACGACCTCGAGCTCCAGCAAGCCAGCTTCCTCGGCACCCCTGCCCCTAAATAA
Predicted protein sequences of Glyma11g28430
>Glyma11g28430.1   sequence type=predicted peptide   gene model=Glyma11g28430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRRGGVSLPDRPSNNSSSVLTNISCSSIVTRGKEAAGDAAFVTKKLLRNTGKVTWIIDTTFLFLVVPLIVKMDREQQLNDLELQQASFLGTPAPK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo