SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27705): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27705): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27705

Feature Type:gene_model
Chromosome:Gm11
Start:27557089
stop:27557448
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g27705
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58600AT Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF828) | chr5:23683944-23685679 REVERSE LENGTH=402 SoyBaseE_val: 5.00E-38ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13533Panther FAMILY NOT NAMED JGI ISS
PTHR13533:SF3Panther gb def: unknown protein [takifugu rubripes] JGI ISS
PF03005PFAM Arabidopsis proteins of unknown function JGI ISS
UniRef100_E4MYC2UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-48-D04 n=1 Tax=Eutrema halophilum RepID=E4MYC2_THEHA SoyBaseE_val: 3.00E-35ISS
UniRef100_I1LLM3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLM3_SOYBN SoyBaseE_val: 3.00E-73ISS

Expression Patterns of Glyma11g27705
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27705 not represented in the dataset
Glyma11g27705 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g27705 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g170500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g27705
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g27705
>Glyma11g27705.1   sequence type=CDS   gene model=Glyma11g27705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTGTTATGCAGCCCAAATGAATGGAATTCTGGAGTGACAGCCGGACTGACTACAAAGAACTGCTATGGTGAAACTACTCCAATTACTAGCACTGGCACATCATACCCTGGTGTGTACCCAGAACAAATGAGGGTTGTGGACATGATAATTAGAGGAATGAGTAACCCTGCTTATCTTCTTGATATCACAATGCTGTCAGCATTTAGGAAGGATGCATGTCCCTCCATTTATAGTGGTGATTTGAATCCTCAACAAAGAGTTAACCCTACCTACTCAGCTGATTGTAGCCACTGGTGTCTTCCTGGATTGCCAGATACTTGGAATGAACTATTCTATACTACCTTGTTCTATTAA
Predicted protein sequences of Glyma11g27705
>Glyma11g27705.1   sequence type=predicted peptide   gene model=Glyma11g27705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALLCSPNEWNSGVTAGLTTKNCYGETTPITSTGTSYPGVYPEQMRVVDMIIRGMSNPAYLLDITMLSAFRKDACPSIYSGDLNPQQRVNPTYSADCSHWCLPGLPDTWNELFYTTLFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo