|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G58600 | AT | Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF828) | chr5:23683944-23685679 REVERSE LENGTH=402 | SoyBase | E_val: 5.00E-38 | ISS |
| GO:0006333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly | SoyBase | N/A | ISS |
| GO:0009620 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fungus | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR13533 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR13533:SF3 | Panther | gb def: unknown protein [takifugu rubripes] | JGI | ISS | |
| PF03005 | PFAM | Arabidopsis proteins of unknown function | JGI | ISS | |
| UniRef100_E4MYC2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-48-D04 n=1 Tax=Eutrema halophilum RepID=E4MYC2_THEHA | SoyBase | E_val: 3.00E-35 | ISS |
| UniRef100_I1LLM3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLM3_SOYBN | SoyBase | E_val: 3.00E-73 | ISS |
|
Glyma11g27705 not represented in the dataset |
Glyma11g27705 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g170500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g27705.1 sequence type=CDS gene model=Glyma11g27705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCATTGTTATGCAGCCCAAATGAATGGAATTCTGGAGTGACAGCCGGACTGACTACAAAGAACTGCTATGGTGAAACTACTCCAATTACTAGCACTGGCACATCATACCCTGGTGTGTACCCAGAACAAATGAGGGTTGTGGACATGATAATTAGAGGAATGAGTAACCCTGCTTATCTTCTTGATATCACAATGCTGTCAGCATTTAGGAAGGATGCATGTCCCTCCATTTATAGTGGTGATTTGAATCCTCAACAAAGAGTTAACCCTACCTACTCAGCTGATTGTAGCCACTGGTGTCTTCCTGGATTGCCAGATACTTGGAATGAACTATTCTATACTACCTTGTTCTATTAA
>Glyma11g27705.1 sequence type=predicted peptide gene model=Glyma11g27705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MALLCSPNEWNSGVTAGLTTKNCYGETTPITSTGTSYPGVYPEQMRVVDMIIRGMSNPAYLLDITMLSAFRKDACPSIYSGDLNPQQRVNPTYSADCSHWCLPGLPDTWNELFYTTLFY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||