Glyma11g27690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27690

Feature Type:	gene_model
Chromosome:	Gm11
Start:	27547166
stop:	27547648
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g27690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63470	AT	Annotation by Michelle Graham. TAIR10: serine carboxypeptidase-like 40 \| chr3:23438561-23440862 FORWARD LENGTH=502	SoyBase	E_val: 8.00E-61	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004185	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type carboxypeptidase activity	SoyBase	N/A	ISS
PTHR11802	Panther	SERINE PROTEASE FAMILY S10 SERINE CARBOXYPEPTIDASE	JGI		ISS
PTHR11802:SF8	Panther	SERINE CARBOXYPEPTIDASE II (CARBOXYPEPTIDASE D) (PLANTS)	JGI		ISS
PF00450	PFAM	Serine carboxypeptidase	JGI		ISS
UniRef100_G7IZJ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine carboxypeptidase-like protein n=1 Tax=Medicago truncatula RepID=G7IZJ6_MEDTR	SoyBase	E_val: 4.00E-69	ISS
UniRef100_I1LNY6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LNY6_SOYBN	SoyBase	E_val: 2.00E-82	ISS

Expression Patterns of Glyma11g27690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27690 not represented in the dataset	Glyma11g27690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g27690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma11g27690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g27690

Limit To All Plant Sequences

>Glyma11g27690.1   sequence type=CDS   gene model=Glyma11g27690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTCCTGCATGTTCATCTCTTGGCTATGGAGCAATGCAAGAACTTAGACCTTTTCGAGTAAACAGTGATGGCAAAACACTACACAGAAATATATTTTCTTGGAACAAAGTTGCAAATGTTTTATTCTTGGAGTCACCTGCTGGAGTAGGATTTTCCTATTCAAACAAATCAAAAGATTATGATAACAATGGAGATAAGAAAACAGCTGCAGACAATTATTTATTCTTCGTGAATTGGTTGGAGAGATATCCAGAATATAAGGAAAGAGATTTCTATATTGCTGGGGAAAGCTATGCTGGGCATTATGTGCCTCAACTTGCACATACCATTCTCTATCATAACAAAAAGGCAAATAAGAAAATCATCAACCTCAAAGGAATCTTG

Predicted protein sequences of Glyma11g27690

Limit To All Plant Sequences

>Glyma11g27690.1   sequence type=predicted peptide   gene model=Glyma11g27690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GPACSSLGYGAMQELRPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDNNGDKKTAADNYLFFVNWLERYPEYKERDFYIAGESYAGHYVPQLAHTILYHNKKANKKIINLKGIL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain