SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27680

Feature Type:gene_model
Chromosome:Gm11
Start:27546854
stop:27548527
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36880AT Annotation by Michelle Graham. TAIR10: methionine adenosyltransferase 3 | chr2:15479721-15480893 REVERSE LENGTH=390 SoyBaseE_val: 3.00E-58ISS
GO:0006556GO-bp Annotation by Michelle Graham. GO Biological Process: S-adenosylmethionine biosynthetic process SoyBaseN/AISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004478GO-mf Annotation by Michelle Graham. GO Molecular Function: methionine adenosyltransferase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11964Panther S-ADENOSYLMETHIONINE SYNTHETASE JGI ISS
PF02773PFAM S-adenosylmethionine synthetase, C-terminal domain JGI ISS
UniRef100_I1LZ62UniRef Annotation by Michelle Graham. Best UniRef hit: S-adenosylmethionine synthase n=1 Tax=Glycine max RepID=I1LZ62_SOYBN SoyBaseE_val: 2.00E-64ISS
UniRef100_I1LZ62UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine synthase n=1 Tax=Glycine max RepID=I1LZ62_SOYBN SoyBaseE_val: 2.00E-64ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27680 not represented in the dataset

Glyma11g27680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g27680.1   sequence type=CDS   gene model=Glyma11g27680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GACCTCATGGAGATGCAGGACTCATTGGGAGGAAGATCATCATTGATACCTATGGTGGGTGGGGTGCTCATGGTGGAGGAGGTGCCTTCTCACCCAAGGAGAAGTGGGTTGGTTCAGACCCAAATAGGCCTTGCATACATTGTTAGGCAAGCAGCAAAGAGTGTGGTGGCTTCAGGGCTTGCGTGCCATTGCATTGTGCAAGTTTCCTATGTAATTGGGGTGCCTGATCCACTGTCTGTGTTTGTGGATACCTACAAAACTGGGAAGATTCCAGATAGTGATATTCTGGCTTTGATTAAGGAGCATTTTGACTTCAGGCCTGGAATGATTTCCATCAATCTTGACCTCATGAGAGGGGGAAACTTCAGGTACCAGAAGGCTGCTGCTTATGGCCATTTTGGAAGAGATGATCCTAATTTCACATGGGAGACACTGAAGATACTCAAGCCC

>Glyma11g27680.1   sequence type=predicted peptide   gene model=Glyma11g27680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DLMEMQDSLGGRSSLIPMVGGVLMVEEVPSHPRRSGLVQTQIGLAYIVRQAAKSVVASGLACHCIVQVSYVIGVPDPLSVFVDTYKTGKIPDSDILALIKEHFDFRPGMISINLDLMRGGNFRYQKAAAYGHFGRDDPNFTWETLKILKP







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo