SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27566): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27566): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27566

Feature Type:gene_model
Chromosome:Gm11
Start:27372390
stop:27374503
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23880AT Annotation by Michelle Graham. TAIR10: cleavage and polyadenylation specificity factor 100 | chr5:8052550-8058147 FORWARD LENGTH=739 SoyBaseE_val: 4.00E-60ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006378GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA polyadenylation SoyBaseN/AISS
GO:0006379GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA cleavage SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006397GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA processing SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016569GO-bp Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0035194GO-bp Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing by RNA SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005847GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mRNA cleavage and polyadenylation specificity factor complex SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR11203Panther CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR JGI ISS
PTHR11203:SF5Panther gb def: f19f10.12.p [caenorhabditis elegans] JGI ISS
PF07521PFAM RNA-metabolising metallo-beta-lactamase JGI ISS
UniRef100_B9RVY3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cleavage and polyadenylation specificity factor, putative n=1 Tax=Ricinus communis RepID=B9RVY3_RICCO SoyBaseE_val: 2.00E-65ISS
UniRef100_UPI0002338605UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338605 related cluster n=1 Tax=unknown RepID=UPI0002338605 SoyBaseE_val: 1.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27566 not represented in the dataset

Glyma11g27566 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g27566.1   sequence type=CDS   gene model=Glyma11g27566   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTTGAAGGACGTTCAGATGGAAGATCCATTAAAAATATTCTCTCTCATGTGGCTCCCTTGAAGCTGGTTTTGGTGCATGGATCAGCTGAAGCTACAGAGCATCTGAAACAGCACTGCCTGAAGCATGTCTGTCCACATGTTTATGCTCCCCAAATTGAAGAGACAATTGATGTTACCTCTGATTTATGTGCTTATAAGGTTCAACTGTCTGAGAAGCTCATGAGTAATGTACTCTTCAAAAAGCTGGGAGATTATGAAATAGCTTGGGTTGATGCTGTAGTAGGGAAGACAGAAAATGATCCGCTTTCGCTGCTCCCTGTTTCTGGAGCAGCTCCTCCGCTTTCGCTTTCGCTTTTCCTTTATAAAGTTTCCTTCTGGTTTATGATCCATTAA

>Glyma11g27566.1   sequence type=predicted peptide   gene model=Glyma11g27566   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFEGRSDGRSIKNILSHVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPLSLSLFLYKVSFWFMIH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo