Report for Sequence Feature Glyma11g27333
Feature Type: gene_model
Chromosome: Gm11
Start: 26984642
stop: 26987269
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g27333
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G30000 AT
Annotation by Michelle Graham. TAIR10: PHF5-like protein | chr2:12804042-12804374 REVERSE LENGTH=110
SoyBase E_val: 1.00E-75 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
KOG1705
KOG
Uncharacterized conserved protein, contains CXXC motifs
JGI ISS
PTHR13120 Panther
FAMILY NOT NAMED
JGI ISS
PF03660 PFAM
PHF5-like protein
JGI ISS
UniRef100_A9P9G1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=13 Tax=Magnoliophyta RepID=A9P9G1_POPTR
SoyBase E_val: 4.00E-73 ISS
UniRef100_B6T4K0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: PHD finger-like domain-containing protein 5A n=3 Tax=Poaceae RepID=B6T4K0_MAIZE
SoyBase E_val: 5.00E-73 ISS
Expression Patterns of Glyma11g27333
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma11g27333
Paralog Evidence Comments
Glyma18g06890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma11g27333 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g173100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g27333
Coding sequences of Glyma11g27333
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g27333.1 sequence type=CDS gene model=Glyma11g27333 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCAAGCATCATCCTGATTTGATTATGTGCCGGAAGCAGCCAGGGATTGCCATTGGACGACTGTGCGAGAAATGTGACGGCAAGTGTGTGATCTGTGACTCTTATGTGCGTCCTTGTACGCTTGTCCGAGTTTGTGATGAATGCAACTATGGATCATTTCAGGGTCGATGTGTCATATGCGGAGGAGTTGGAATATCTGATGCCTACTACTGCAAGGAATGCACACAGCAGGAGAAAGATAGAGATGGTTGCCCCAAAATTGTTAATTTAGGGAGTGCCAAAACTGATTTATTTTATGAACGCAAAAAGTATGGTTTTAAGAAGAGATGA
Predicted protein sequences of Glyma11g27333
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g27333.1 sequence type=predicted peptide gene model=Glyma11g27333 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR*