SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g27333

Feature Type:gene_model
Chromosome:Gm11
Start:26984642
stop:26987269
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30000AT Annotation by Michelle Graham. TAIR10: PHF5-like protein | chr2:12804042-12804374 REVERSE LENGTH=110 SoyBaseE_val: 1.00E-75ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
KOG1705 KOG Uncharacterized conserved protein, contains CXXC motifs JGI ISS
PTHR13120Panther FAMILY NOT NAMED JGI ISS
PF03660PFAM PHF5-like protein JGI ISS
UniRef100_A9P9G1UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=13 Tax=Magnoliophyta RepID=A9P9G1_POPTR SoyBaseE_val: 4.00E-73ISS
UniRef100_B6T4K0UniRef Annotation by Michelle Graham. Most informative UniRef hit: PHD finger-like domain-containing protein 5A n=3 Tax=Poaceae RepID=B6T4K0_MAIZE SoyBaseE_val: 5.00E-73ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27333 not represented in the dataset

Glyma11g27333 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g06890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g173100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g27333.1   sequence type=CDS   gene model=Glyma11g27333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAGCATCATCCTGATTTGATTATGTGCCGGAAGCAGCCAGGGATTGCCATTGGACGACTGTGCGAGAAATGTGACGGCAAGTGTGTGATCTGTGACTCTTATGTGCGTCCTTGTACGCTTGTCCGAGTTTGTGATGAATGCAACTATGGATCATTTCAGGGTCGATGTGTCATATGCGGAGGAGTTGGAATATCTGATGCCTACTACTGCAAGGAATGCACACAGCAGGAGAAAGATAGAGATGGTTGCCCCAAAATTGTTAATTTAGGGAGTGCCAAAACTGATTTATTTTATGAACGCAAAAAGTATGGTTTTAAGAAGAGATGA

>Glyma11g27333.1   sequence type=predicted peptide   gene model=Glyma11g27333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo