Glyma11g27333 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g27333

Feature Type:	gene_model
Chromosome:	Gm11
Start:	26984642
stop:	26987269
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g27333

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30000	AT	Annotation by Michelle Graham. TAIR10: PHF5-like protein \| chr2:12804042-12804374 REVERSE LENGTH=110	SoyBase	E_val: 1.00E-75	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
KOG1705	KOG	Uncharacterized conserved protein, contains CXXC motifs	JGI		ISS
PTHR13120	Panther	FAMILY NOT NAMED	JGI		ISS
PF03660	PFAM	PHF5-like protein	JGI		ISS
UniRef100_A9P9G1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=13 Tax=Magnoliophyta RepID=A9P9G1_POPTR	SoyBase	E_val: 4.00E-73	ISS
UniRef100_B6T4K0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PHD finger-like domain-containing protein 5A n=3 Tax=Poaceae RepID=B6T4K0_MAIZE	SoyBase	E_val: 5.00E-73	ISS

Expression Patterns of Glyma11g27333

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27333 not represented in the dataset	Glyma11g27333 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g27333

Paralog	Evidence	Comments
Glyma18g06890	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g27333 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g173100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g27333

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g27333

Limit To All Plant Sequences

>Glyma11g27333.1   sequence type=CDS   gene model=Glyma11g27333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAGCATCATCCTGATTTGATTATGTGCCGGAAGCAGCCAGGGATTGCCATTGGACGACTGTGCGAGAAATGTGACGGCAAGTGTGTGATCTGTGACTCTTATGTGCGTCCTTGTACGCTTGTCCGAGTTTGTGATGAATGCAACTATGGATCATTTCAGGGTCGATGTGTCATATGCGGAGGAGTTGGAATATCTGATGCCTACTACTGCAAGGAATGCACACAGCAGGAGAAAGATAGAGATGGTTGCCCCAAAATTGTTAATTTAGGGAGTGCCAAAACTGATTTATTTTATGAACGCAAAAAGTATGGTTTTAAGAAGAGATGA

Predicted protein sequences of Glyma11g27333

Limit To All Plant Sequences

>Glyma11g27333.1   sequence type=predicted peptide   gene model=Glyma11g27333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain