SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27235): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27235): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27235

Feature Type:gene_model
Chromosome:Gm11
Start:26821321
stop:26822766
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g27235
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32820AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr4:15831679-15841454 REVERSE LENGTH=1863 SoyBaseE_val: 1.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
UniRef100_D7M9N9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Binding protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M9N9_ARALL SoyBaseE_val: 2.00E-14ISS
UniRef100_UPI000233A49DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A49D related cluster n=1 Tax=unknown RepID=UPI000233A49D SoyBaseE_val: 2.00E-32ISS

Expression Patterns of Glyma11g27235
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27235 not represented in the dataset
Glyma11g27235 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g27235 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g174000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g27235
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g27235
>Glyma11g27235.1   sequence type=CDS   gene model=Glyma11g27235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACTAGTATTGGAGGGATGGTTGGAAATTTTTATGTATCTTCAAGGTGTATCTGTGCAGATAATCAAGTTGCAGGTTCTGGCCTGTCTTTTGAGTTTTCATTATGTATTGAAGATCTTATACTTGTGGCTATTGGAAGGTATCTAAAGGCCTTGATTGCAACTATGTGCCATTATCAGACTACTGCCTCTAGTTTAGTGAGGAGTTCTGACAATGTGCTGGAGAGAATGTTTGCATTGCTCATGGAGCAAGGGAGCTTATGGCAAGAAATATGCAGCTTGCCTGAAATTGAAGGCTCAGTTATATCATAG
Predicted protein sequences of Glyma11g27235
>Glyma11g27235.1   sequence type=predicted peptide   gene model=Glyma11g27235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTSIGGMVGNFYVSSRCICADNQVAGSGLSFEFSLCIEDLILVAIGRYLKALIATMCHYQTTASSLVRSSDNVLERMFALLMEQGSLWQEICSLPEIEGSVIS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo