Glyma11g27100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27100

Feature Type:	gene_model
Chromosome:	Gm11
Start:	26686542
stop:	26688198
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g27100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48170	AT	Annotation by Michelle Graham. TAIR10: aldehyde dehydrogenase 10A9 \| chr3:17786290-17789918 REVERSE LENGTH=503	SoyBase	E_val: 6.00E-24	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0046685	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004028	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 3-chloroallyl aldehyde dehydrogenase activity	SoyBase	N/A	ISS
GO:0004029	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aldehyde dehydrogenase (NAD) activity	SoyBase	N/A	ISS
GO:0008802	GO-mf	Annotation by Michelle Graham. GO Molecular Function: betaine-aldehyde dehydrogenase activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
PTHR11699	Panther	ALDEHYDE DEHYDROGENASE-RELATED	JGI		ISS
PTHR11699:SF45	Panther	gb def: succinic-semialdehyde dehydrogenase, putative [deinococcus radiodurans]	JGI		ISS
PF00171	PFAM	Aldehyde dehydrogenase family	JGI		ISS
UniRef100_B0M1A6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Betaine aldehyde dehydrogenase n=1 Tax=Glycine max RepID=B0M1A6_SOYBN	SoyBase	E_val: 6.00E-27	ISS
UniRef100_I1LLK5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LLK5_SOYBN	SoyBase	E_val: 4.00E-108	ISS

Expression Patterns of Glyma11g27100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27100 not represented in the dataset	Glyma11g27100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g27100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g174600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g27100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g27100

Limit To All Plant Sequences

>Glyma11g27100.1   sequence type=CDS   gene model=Glyma11g27100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACAATAACCTTTTCAGCTTTTTTAAGCTTCTAATGCTAGAAAGGATTGACCCAAATATCCTATTTTCATGCAGTGGCAGTTCTTGGTGGTTTGGCAAGTCACAAAGGCTTTTTGGTACTGGGCCAGAGGTTTGGAATTTGCAAACCAATTATTTGTGGAATTGTCCTACTACTGAATGGACCGTCTTTGGTTGCTTCTTTACAAATGGTCTGATATGCAATACCACATGCCACCTTATTGTACATGAAAGTATAGCAACAAAATTTGTGAATATACTTGTGCAATGGGCCAAAAACATCAAAATTTCATATCCCTTTGAAGAAGGTTGTAGGCTAGGTCCTATTTTTTCCATCTTTTTCTTTATCACTAGCACTAATGTGGCAGGAGAAATAGTTGAGATCGGACAAGTCAAAGATTTCAAAGTTGGCGACAAAGTTCTTGCTAAACTCAACCATCAAGTATTCTAA

Predicted protein sequences of Glyma11g27100

Limit To All Plant Sequences

>Glyma11g27100.1   sequence type=predicted peptide   gene model=Glyma11g27100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NNNLFSFFKLLMLERIDPNILFSCSGSSWWFGKSQRLFGTGPEVWNLQTNYLWNCPTTEWTVFGCFFTNGLICNTTCHLIVHESIATKFVNILVQWAKNIKISYPFEEGCRLGPIFSIFFFITSTNVAGEIVEIGQVKDFKVGDKVLAKLNHQVF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain