SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g27070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g27070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g27070

Feature Type:gene_model
Chromosome:Gm11
Start:26625418
stop:26626178
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g27070
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13170AT Annotation by Michelle Graham. TAIR10: senescence-associated gene 29 | chr5:4181331-4183171 REVERSE LENGTH=292 SoyBaseE_val: 3.00E-22ISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0015770GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose transport SoyBaseN/AISS
GO:0071215GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to abscisic acid stimulus SoyBaseN/AISS
GO:0071446GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to salicylic acid stimulus SoyBaseN/AISS
GO:0071470GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to osmotic stress SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005887GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008515GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose transmembrane transporter activity SoyBaseN/AISS
GO:0051119GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar transmembrane transporter activity SoyBaseN/AISS
PTHR10791Panther STROMAL CELL PROTEIN/NODULIN MTN3-RELATED JGI ISS
PF03083PFAM MtN3/saliva family JGI ISS
UniRef100_C6T950UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T950_SOYBN SoyBaseE_val: 3.00E-45ISS
UniRef100_G7KWL9UniRef Annotation by Michelle Graham. Most informative UniRef hit: RAG1-activating protein-like protein n=1 Tax=Medicago truncatula RepID=G7KWL9_MEDTR SoyBaseE_val: 6.00E-21ISS

Expression Patterns of Glyma11g27070
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g27070 not represented in the dataset
Glyma11g27070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g27070 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma11g27070
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g27070
>Glyma11g27070.1   sequence type=CDS   gene model=Glyma11g27070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAACTGGCGATACTACTTAATAGTTTGTGTTACACTATTATATCATCTAGGGTGGATTGTCTTTGCATCACCTCTAAGCATTATGTGATTAGAACAAATAGTGTACAGTTTATGCCCTTCTATTTGTCATTTTTCCTCACATTGAATGCCATAACGTGGTTTGTATATGGTTTGTCTATGCAAGACAAATGCATTTATATTCCAAATGTGGGAGGGTTTGCACTGGGGCTAGTTCAGATGGTGCTATATGACATTTATAGGAAGGGCACTGAGAGTGAGAAGGAGCAAGGTTTAGGTGAAGGAGTGATAAACATTGTTTGGTATTTGAATAACCTAGCTTTCAATTCTGTAAAAAAAAAAAGTAACTCGAACGAAAAAAAATAA
Predicted protein sequences of Glyma11g27070
>Glyma11g27070.1   sequence type=predicted peptide   gene model=Glyma11g27070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKLAILLNSLCYTIISSRVDCLCITSKHYVIRTNSVQFMPFYLSFFLTLNAITWFVYGLSMQDKCIYIPNVGGFALGLVQMVLYDIYRKGTESEKEQGLGEGVINIVWYLNNLAFNSVKKKSNSNEKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo