SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g26970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g26970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g26970

Feature Type:gene_model
Chromosome:Gm11
Start:26549636
stop:26552091
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g26970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58740AT Annotation by Michelle Graham. TAIR10: HSP20-like chaperones superfamily protein | chr5:23725936-23727528 REVERSE LENGTH=158 SoyBaseE_val: 4.00E-108ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG2265 KOG Nuclear distribution protein NUDC JGI ISS
PTHR12356Panther NUCLEAR MOVEMENT PROTEIN NUDC JGI ISS
PF04969PFAM CS domain JGI ISS
UniRef100_I1LLK0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLK0_SOYBN SoyBaseE_val: 3.00E-115ISS
UniRef100_Q8VXX3UniRef Annotation by Michelle Graham. Most informative UniRef hit: NudC domain-containing protein n=2 Tax=Arabidopsis thaliana RepID=Q8VXX3_ARATH SoyBaseE_val: 2.00E-105ISS

Expression Patterns of Glyma11g26970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g26970 not represented in the dataset
Glyma11g26970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g26970
ParalogEvidenceComments
Glyma18g07050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g26970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g175500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g26970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g26970
>Glyma11g26970.1   sequence type=CDS   gene model=Glyma11g26970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAAAAATTAGCCCCGGAAAAGCGTCACAGCTTCGTCCACAACGGTCAAAAGGTGTTCGAGTGGGATCAAACCCTTGACGAGGTCAATATTTACATAGCTCTTCCTCCTAACGTTCATTCCAAGCAATTCTACTGTAAGATTCAGTCCAAGCACCTCGAACTTGGCATCAAAGGCAACCCTCCGTATCTCAACCATGATCTTACTAGCCCGGTGAAGACAGATTCTTCTTTTTGGACCTTAGAGGATGACATAATGCACATAACACTGCAGAAAAGAGATAAAGGTCAGACATGGGCTTCTCCCATATCAGGTCAGGGTCAGTTGGACCCTTATGCTACTGATCTTGAGCAGAAGCGACTCATGCTTCAGAGATTTCAAGAGGAGAACCCAGGTTTTGATTTTTCACAAGCTCAATTTTCTGGAAACTGTCCTGATCCAAGAACCTTCATGGGTGGAATCCGATCAGACTGA
Predicted protein sequences of Glyma11g26970
>Glyma11g26970.1   sequence type=predicted peptide   gene model=Glyma11g26970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEKLAPEKRHSFVHNGQKVFEWDQTLDEVNIYIALPPNVHSKQFYCKIQSKHLELGIKGNPPYLNHDLTSPVKTDSSFWTLEDDIMHITLQKRDKGQTWASPISGQGQLDPYATDLEQKRLMLQRFQEENPGFDFSQAQFSGNCPDPRTFMGGIRSD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo