SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g26365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g26365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g26365

Feature Type:gene_model
Chromosome:Gm11
Start:25144284
stop:25145682
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G06900AT Annotation by Michelle Graham. TAIR10: Insulinase (Peptidase family M16) family protein | chr1:2115155-2120635 REVERSE LENGTH=1024 SoyBaseE_val: 9.00E-76ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR11851Panther METALLOPROTEASE JGI ISS
PTHR11851:SF66Panther N-ARGININE DIBASIC CONVERTASE-RELATED JGI ISS
UniRef100_D7KG76UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metalloendopeptidase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KG76_ARALL SoyBaseE_val: 3.00E-73ISS
UniRef100_UPI000233D5ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D5AD related cluster n=1 Tax=unknown RepID=UPI000233D5AD SoyBaseE_val: 5.00E-124ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g26365 not represented in the dataset

Glyma11g26365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g06030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g26365.1   sequence type=CDS   gene model=Glyma11g26365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACAAAAGAGCAGCTTGGTTATGTTGTTGAATGCAGCCCACGAGTAACATATCGTATCTCTGGGTTTTGTTTCTGCGTTCAGTCATCTGAGTACCACCCAGTTTACTTGCAAAGTAGAATTGAAAACTTCTTAAATGGCCTGGAAGAATTGTTGGATGGGCTTGATGGTGATTCCTTTGAGAATTACAAAAGTGGGTTAATGGCAAAGCTGCTGGAGAAAGACCCTTCACTCACATATGAAAGCAATAGATTGTGGAACCAAATTGTTGAAAAAAGGTATATCTTTGACTTGTCAAAGAAGGAAGCAGAAGAATTGAAGAACATAAGTAAGCATGATGTTGTTGAATGGTACAAGACTTACTTAAAACCGTCGTCTCCAAAGTGCCGACAACTACTTATTCGGCTATGGGGTTGCAACACAGACTTGAAAGAAGCTGAAGCACTACCCAAATCTGTGCAGGTAATTACAGATCCAGCAGCTTTTAAGATGCAATCCAAGTTTTATCCAAGTTTTTGTTAA

>Glyma11g26365.1   sequence type=predicted peptide   gene model=Glyma11g26365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TKEQLGYVVECSPRVTYRISGFCFCVQSSEYHPVYLQSRIENFLNGLEELLDGLDGDSFENYKSGLMAKLLEKDPSLTYESNRLWNQIVEKRYIFDLSKKEAEELKNISKHDVVEWYKTYLKPSSPKCRQLLIRLWGCNTDLKEAEALPKSVQVITDPAAFKMQSKFYPSFC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo