Report for Sequence Feature Glyma11g25990
Feature Type: gene_model
Chromosome: Gm11
Start: 24725052
stop: 24725624
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g25990
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_G7KNJ8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CCP-like protein n=1 Tax=Medicago truncatula RepID=G7KNJ8_MEDTR
SoyBase E_val: 9.00E-09 ISS
UniRef100_I1LLH7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LLH7_SOYBN
SoyBase E_val: 7.00E-65 ISS
Expression Patterns of Glyma11g25990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma11g25990 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g159100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g25990
Coding sequences of Glyma11g25990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g25990.1 sequence type=CDS gene model=Glyma11g25990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCATTTGTTACATAATAAACATTCTTTGGCGATCATGTTGTATGATAGGATGGACTCTACAAGGAAGTCTTCTCTCACATTGGTATTCTTATTGGCTTTTTTCATCATTGCTTCAGATATGGGTATGAAATCTGAAGCGCAAATATCTCCACTTGCACGCTGTTCCAAAGACTCAGATTGTAAACGTTATTGTCCAACTTGTTATCAATGTAATTGTGTGCGACGTGTTTGTTTGTGCGAAAACTCACCACCTTTAGCCAATAATATTCATAGTCAAGCTCCCCCATATTGA
Predicted protein sequences of Glyma11g25990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g25990.1 sequence type=predicted peptide gene model=Glyma11g25990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHLLHNKHSLAIMLYDRMDSTRKSSLTLVFLLAFFIIASDMGMKSEAQISPLARCSKDSDCKRYCPTCYQCNCVRRVCLCENSPPLANNIHSQAPPY*