SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g24062): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g24062): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g24062

Feature Type:gene_model
Chromosome:Gm11
Start:21693751
stop:21694605
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g24062
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59970AT Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr5:24146352-24146663 REVERSE LENGTH=103 SoyBaseE_val: 7.00E-67ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG3467 KOG Histone H4 JGI ISS
PTHR10484Panther HISTONE H4 JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_B6T0P4UniRef Annotation by Michelle Graham. Best UniRef hit: Histone H4 n=1 Tax=Zea mays RepID=B6T0P4_MAIZE SoyBaseE_val: 2.00E-65ISS
UniRef100_B6T0P4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H4 n=1 Tax=Zea mays RepID=B6T0P4_MAIZE SoyBaseE_val: 2.00E-65ISS

Expression Patterns of Glyma11g24062
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g24062 not represented in the dataset
Glyma11g24062 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g24062 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g177800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g24062
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g24062
>Glyma11g24062.1   sequence type=CDS   gene model=Glyma11g24062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTCGTGGAAAGGGTGGCAAGGGTTTGGGAAAGGGAGGTGCCAAGAGGCACAGGAAGGTTCTGCGCGATAACATTCAAGGAATCACGAAACCTGCGATTCGTAGGTTAGCGAGAAGAGGTGGCGTGAAAAGGATCAGTGGTTTGATCTACGAGGAAACCAGAGGAGTTCTGAAGATATTCTTGGAGAACGTGATTCGTGATGCTGTGACCTACACTGAGCACGCTAGGAGGAAGACAGTGACTGCTATGGACGTGGTTTATGCTCTTAAGAGGCAGGGAAGGACCCTCTACGGTTTTGGAGGCTGA
Predicted protein sequences of Glyma11g24062
>Glyma11g24062.1   sequence type=predicted peptide   gene model=Glyma11g24062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo