|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G58930 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF740) | chr5:23794529-23796094 REVERSE LENGTH=521 | SoyBase | E_val: 8.00E-16 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF05340 | PFAM | Protein of unknown function (DUF740) | JGI | ISS | |
| UniRef100_I1LLF0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLF0_SOYBN | SoyBase | E_val: 6.00E-76 | ISS |
| UniRef100_Q9FIL8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB61945.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FIL8_ARATH | SoyBase | E_val: 4.00E-13 | ISS |
|
Glyma11g23443 not represented in the dataset |
Glyma11g23443 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g23443.1 sequence type=CDS gene model=Glyma11g23443 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTAATGAGCCAATTGCAGAGTCTTGGCAGAAGCTAAGGAGGGTGGTTAATGGACAAGCAAGCGAGTCGGTTTGTGAGAAGCTTATTCGTAGCCATAGTGTTTGTTGTAGAGATCCTTGTAGAACGGTGGGTTTAGCCAATGGCTTTGTGGGTTCTGAGACTAAAGGCCATGTTTTCAATGGAAGGCAGAAGTTTATGCTTCAGAGGAACCGGAGTGTTAGGTATTCACCAAGTAATGCTGACAATGGCTTGTTAAGGTTCTATTTGACACCCTTGAAAAGCTATAGGAGAAGCAGGTCTGGAAAGACTAGCTTAAAGAGTTCAAATCCAACAGCCAGAAGTTTCTTTTGA
>Glyma11g23443.1 sequence type=predicted peptide gene model=Glyma11g23443 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVNEPIAESWQKLRRVVNGQASESVCEKLIRSHSVCCRDPCRTVGLANGFVGSETKGHVFNGRQKFMLQRNRSVRYSPSNADNGLLRFYLTPLKSYRRSRSGKTSLKSSNPTARSFF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||