Glyma11g23443 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g23443): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g23443): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g23443

Feature Type:	gene_model
Chromosome:	Gm11
Start:	20952911
stop:	20953264
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g23443

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G58930	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF740) \| chr5:23794529-23796094 REVERSE LENGTH=521	SoyBase	E_val: 8.00E-16	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0009887	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ morphogenesis	SoyBase	N/A	ISS
GO:0010051	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation	SoyBase	N/A	ISS
GO:0048439	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower morphogenesis	SoyBase	N/A	ISS
GO:0048519	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05340	PFAM	Protein of unknown function (DUF740)	JGI		ISS
UniRef100_I1LLF0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLF0_SOYBN	SoyBase	E_val: 6.00E-76	ISS
UniRef100_Q9FIL8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Emb\|CAB61945.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FIL8_ARATH	SoyBase	E_val: 4.00E-13	ISS

Expression Patterns of Glyma11g23443

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g23443 not represented in the dataset	Glyma11g23443 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g23443 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma11g23443

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g23443

Limit To All Plant Sequences

>Glyma11g23443.1   sequence type=CDS   gene model=Glyma11g23443   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAATGAGCCAATTGCAGAGTCTTGGCAGAAGCTAAGGAGGGTGGTTAATGGACAAGCAAGCGAGTCGGTTTGTGAGAAGCTTATTCGTAGCCATAGTGTTTGTTGTAGAGATCCTTGTAGAACGGTGGGTTTAGCCAATGGCTTTGTGGGTTCTGAGACTAAAGGCCATGTTTTCAATGGAAGGCAGAAGTTTATGCTTCAGAGGAACCGGAGTGTTAGGTATTCACCAAGTAATGCTGACAATGGCTTGTTAAGGTTCTATTTGACACCCTTGAAAAGCTATAGGAGAAGCAGGTCTGGAAAGACTAGCTTAAAGAGTTCAAATCCAACAGCCAGAAGTTTCTTTTGA

Predicted protein sequences of Glyma11g23443

Limit To All Plant Sequences

>Glyma11g23443.1   sequence type=predicted peptide   gene model=Glyma11g23443   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNEPIAESWQKLRRVVNGQASESVCEKLIRSHSVCCRDPCRTVGLANGFVGSETKGHVFNGRQKFMLQRNRSVRYSPSNADNGLLRFYLTPLKSYRRSRSGKTSLKSSNPTARSFF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain