SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g23096): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g23096): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g23096

Feature Type:gene_model
Chromosome:Gm11
Start:20468025
stop:20474140
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g23096
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70590AT Annotation by Michelle Graham. TAIR10: F-box family protein | chr1:26618403-26620159 FORWARD LENGTH=351 SoyBaseE_val: 7.00E-31ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
PTHR11102Panther SEL-1-LIKE PROTEINS JGI ISS
PTHR11102:SF7Panther gb def: unknown [pasteurella multocida] JGI ISS
PF08238PFAM Sel1 repeat JGI ISS
UniRef100_G7JYY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F-box protein n=1 Tax=Medicago truncatula RepID=G7JYY5_MEDTR SoyBaseE_val: 1.00E-39ISS
UniRef100_I1LLE8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLE8_SOYBN SoyBaseE_val: 1.00E-65ISS

Expression Patterns of Glyma11g23096
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g23096 not represented in the dataset
Glyma11g23096 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g23096 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g176600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g23096
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g23096
>Glyma11g23096.1   sequence type=CDS   gene model=Glyma11g23096   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGCATTTATCGTCTTCACTTATCGTTGGGTTTCCAAAATGGAACTGCTGCTCCAGCCACCACCACGTCCACCCAGCGATGACAGTGGCGAACAGCACCAGCTAGTGCCTCCTCAAGTACATCCTCTCACGGTCTCATTCCTCCATGCCAAGAACCCCGACGAGACTTCTCCCCAAACCACCGCCACGGACACCAAGCTCCGCGGCAAGGGAGCGCCACAGGAGGAGTTTAGTGTCGACCACGTGCTGACCAAGCGCCACCGTCGTGAGAAGCTGAATCATAAACAAGCTGAACCCCGGAACACTGAGCTAGCTGTCAAATTGTTACATAAAGCTTCTGTTTGTGGGAATCTTTGTGCCCAGTACCAGCTTGGGCTTTGTCTGCATCGCGGTGGTGGGAGGGCAAAATGGTATATGAAAGTTGCAGAGGGTGGGTATGTCTATGCTATGTTCAATATCTCCTTGTGCTTCTCCTTTGGGGAAGGATTGACACGTAACCATCAACTAGCAAGAAAATGGATGAAGCGGGCTGCGGATCGTGGCCATAGTAAAGCTCAATTTGAGGACATGCTCTCTTTTATGTTAAAGAGAAGCGAGGAGAAATTCAAATAA
Predicted protein sequences of Glyma11g23096
>Glyma11g23096.1   sequence type=predicted peptide   gene model=Glyma11g23096   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCAFIVFTYRWVSKMELLLQPPPRPPSDDSGEQHQLVPPQVHPLTVSFLHAKNPDETSPQTTATDTKLRGKGAPQEEFSVDHVLTKRHRREKLNHKQAEPRNTELAVKLLHKASVCGNLCAQYQLGLCLHRGGGRAKWYMKVAEGGYVYAMFNISLCFSFGEGLTRNHQLARKWMKRAADRGHSKAQFEDMLSFMLKRSEEKFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo