SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g22656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g22656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g22656

Feature Type:gene_model
Chromosome:Gm11
Start:19785070
stop:19786316
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31270AT Annotation by Michelle Graham. TAIR10: homolog of yeast CDT1 A | chr2:13329037-13331544 FORWARD LENGTH=571 SoyBaseE_val: 2.00E-22ISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0016458GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0048229GO-bp Annotation by Michelle Graham. GO Biological Process: gametophyte development SoyBaseN/AISS
GO:0051276GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome organization SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004693GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0019901GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase binding SoyBaseN/AISS
GO:0070182GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA polymerase binding SoyBaseN/AISS
PF08839PFAM DNA replication factor CDT1 like JGI ISS
UniRef100_G7KKA2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial protein, putative n=1 Tax=Medicago truncatula RepID=G7KKA2_MEDTR SoyBaseE_val: 8.00E-45ISS
UniRef100_I1K8N2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8N2_SOYBN SoyBaseE_val: 9.00E-88ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g22656 not represented in the dataset

Glyma11g22656 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g22656.1   sequence type=CDS   gene model=Glyma11g22656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGCTGATTTGTTTGGTCACATGAGTTGTTCACTCAGATTGTTGCATCTGTGTAAAAAGGCTTCAATTTTTCAAAATGTTTGCCGCCAGGTTGAAGTTCTTTCGAAGAGGAAATTCTCCCATGCCCATCTTGCGCAGATGAAGTATATACTCCCTAAAAGTGTGTGTATAGATAGGGTGCTTGTTCATGATAAGAAAAGCTTGTGTATGGTGCCTGATATGAAGATCACCTTGAAATTTGAGGTTGTGGAAGATTGCTCTGGCGAATCTGCTGATCTGGCTCTTCGACGATATTTTAAATCTAAGCTGATTGATTTCTTTGATATGCATCCTGAGGACATGCCTACCCAAAAGTCAACATCATCTTATAAGCCAGGAAAAAGAGTGCTTGACTTTTCCCTCATGGAGGACAATGATGGCTTGGGCATTGAAGTGGACAAGTTAGAATCTATCAGAGCTCTGCATGGATCTATTAGGTAA

>Glyma11g22656.1   sequence type=predicted peptide   gene model=Glyma11g22656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFADLFGHMSCSLRLLHLCKKASIFQNVCRQVEVLSKRKFSHAHLAQMKYILPKSVCIDRVLVHDKKSLCMVPDMKITLKFEVVEDCSGESADLALRRYFKSKLIDFFDMHPEDMPTQKSTSSYKPGKRVLDFSLMEDNDGLGIEVDKLESIRALHGSIR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo