Glyma11g21970 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g21970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g21970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g21970

Feature Type:	gene_model
Chromosome:	Gm11
Start:	19191271
stop:	19192116
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g21970

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G40200	AT	Annotation by Michelle Graham. TAIR10: DegP protease 9 \| chr5:16070402-16073101 FORWARD LENGTH=592	SoyBase	E_val: 1.00E-27	ISS
GO:0006406	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008236	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity	SoyBase	N/A	ISS
PTHR22939	Panther	SERINE PROTEASE FAMILY S1C HTRA-RELATED	JGI		ISS
PTHR22939:SF1	Panther	SERINE ENDOPEPTIDASE DEGP2	JGI		ISS
UniRef100_B9RUD1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine endopeptidase degp2, putative n=1 Tax=Ricinus communis RepID=B9RUD1_RICCO	SoyBase	E_val: 6.00E-27	ISS
UniRef100_I1J6G7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J6G7_SOYBN	SoyBase	E_val: 4.00E-30	ISS

Expression Patterns of Glyma11g21970

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g21970 not represented in the dataset	Glyma11g21970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g21970 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.U023200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g21970

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g21970

Limit To All Plant Sequences

>Glyma11g21970.1   sequence type=CDS   gene model=Glyma11g21970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCAGGCAGGAGGAGGGGCCCTTTTGTTTATTGGAAGGTATGGTAAAGATTATGAATTTGATGCTTCAGTTAAGCTTCTGGACAAACATCTACATTCTAGGGTTCTTGTGTCTGACATCGATATTGGATATGAGGAGATAGTTAACACTCTGGTTCTTGCTTTCAATGGTAAACCTGTGAAGAATCTGAAGAGCTTGGACAACATGGTTGAGAGCTGCGATGATGATTATCTAAATTTTGATCTGGAATACCAACAGGTTTTCTCTCATTGA

Predicted protein sequences of Glyma11g21970

Limit To All Plant Sequences

>Glyma11g21970.1   sequence type=predicted peptide   gene model=Glyma11g21970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQAGGGALLFIGRYGKDYEFDASVKLLDKHLHSRVLVSDIDIGYEEIVNTLVLAFNGKPVKNLKSLDNMVESCDDDYLNFDLEYQQVFSH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain