Glyma11g21756 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g21756): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g21756): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g21756

Feature Type:	gene_model
Chromosome:	Gm11
Start:	18892653
stop:	18893117
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g21756

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16140	AT	Annotation by Michelle Graham. TAIR10: photosystem I subunit H-1 \| chr3:5468670-5469415 REVERSE LENGTH=145	SoyBase	E_val: 5.00E-37	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009522	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009538	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03244	PFAM	Photosystem I reaction centre subunit VI	JGI		ISS
UniRef100_B9RQK6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit VI, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9RQK6_RICCO	SoyBase	E_val: 9.00E-41	ISS
UniRef100_UPI000233D2CE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D2CE related cluster n=1 Tax=unknown RepID=UPI000233D2CE	SoyBase	E_val: 1.00E-65	ISS

Expression Patterns of Glyma11g21756

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g21756 not represented in the dataset	Glyma11g21756 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g21756 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g155800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g21756

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g21756

Limit To All Plant Sequences

>Glyma11g21756.1   sequence type=CDS   gene model=Glyma11g21756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCTAGCAAGCTTAGATATTGTTCAACCATCTACTATCAAGGGCCTTGCTGGATCTTCCCTTACTGGAACTAAGCTCTCTTTCAAGCCCTCTCACCAGAGTTTTAGACCCAAGAATTTCAGGAATGGTGTTGTGGTAGCAAATTATGGTGACAAGAGTGTGTACTTTGATTTGGAGGATCTAGGCAACACTATTGGTCAGTGGGACTTATACGTCTTCGATGCACCTTCACCCTACAACCCTCTTCGGGTTCGTTTTTCCTCTGTGAACCTCTTTATTGTTTATTCATTTAACTAA

Predicted protein sequences of Glyma11g21756

Limit To All Plant Sequences

>Glyma11g21756.1   sequence type=predicted peptide   gene model=Glyma11g21756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLASLDIVQPSTIKGLAGSSLTGTKLSFKPSHQSFRPKNFRNGVVVANYGDKSVYFDLEDLGNTIGQWDLYVFDAPSPYNPLRVRFSSVNLFIVYSFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain