|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G47510 | AT | Annotation by Michelle Graham. TAIR10: fumarase 1 | chr2:19498614-19502020 FORWARD LENGTH=492 | SoyBase | E_val: 3.00E-13 | ISS |
| GO:0006099 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tricarboxylic acid cycle | SoyBase | N/A | ISS |
| GO:0006106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fumarate metabolic process | SoyBase | N/A | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0048868 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube development | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0045239 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: tricarboxylic acid cycle enzyme complex | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004333 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: fumarate hydratase activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0016829 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: lyase activity | SoyBase | N/A | ISS |
| UniRef100_B9SAW4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Aspartate ammonia lyase, putative n=1 Tax=Ricinus communis RepID=B9SAW4_RICCO | SoyBase | E_val: 1.00E-10 | ISS |
| UniRef100_I1JBJ3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBJ3_SOYBN | SoyBase | E_val: 3.00E-11 | ISS |
|
Glyma11g21661 not represented in the dataset |
Glyma11g21661 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g155200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g21661.1 sequence type=CDS gene model=Glyma11g21661 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTATTTTACTCGTCATGGGAAACCATGTTGCAGTCACAGTGGGTGGATCAAATGGTCATTTTGAGCTCAATATGTTCAAGCCAATGTTTGCCAATTATCTTCTCCATGTTAAGCAGACAATCTTTTTGTTAACGACATCATTTTATCCTCCAATGCGATCCTGGGACCTCGCCACAACATCAAAGAATCTTTTTTGTAGATATTTGGATGGAGAATTCAAGTCTGGTGATGATCATAAGTAA
>Glyma11g21661.1 sequence type=predicted peptide gene model=Glyma11g21661 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSILLVMGNHVAVTVGGSNGHFELNMFKPMFANYLLHVKQTIFLLTTSFYPPMRSWDLATTSKNLFCRYLDGEFKSGDDHK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||