SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G28730 | AT | Annotation by Michelle Graham. TAIR10: high mobility group | chr3:10784954-10788498 FORWARD LENGTH=646 | SoyBase | E_val: 5.00E-50 | ISS |
| GO:0000394 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0006366 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem maintenance | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0016569 | GO-bp | Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005719 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nuclear euchromatin | SoyBase | N/A | ISS |
| GO:0035101 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: FACT complex | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| PF03141 | PFAM | Putative methyltransferase | JGI | ISS | |
| PF03531 | PFAM | Structure-specific recognition protein (SSRP1) | JGI | ISS | |
| UniRef100_G7KH07 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: FACT complex subunit SSRP1 n=1 Tax=Medicago truncatula RepID=G7KH07_MEDTR | SoyBase | E_val: 5.00E-62 | ISS |
| UniRef100_I1LWI6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LWI6_SOYBN | SoyBase | E_val: 2.00E-78 | ISS |
|
Glyma11g21340 not represented in the dataset |
Glyma11g21340 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g152900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g21340.1 sequence type=CDS gene model=Glyma11g21340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TATTCAACATACCCCCGAACTTATGATTTACTCCATGCATTGACTGTGTTTTCTGACATTAAAACAAGAGGGTGCAATCAAGAGGATCTATTGATTGAGATGCACCTGGGGAATCGAACCCGCCACCTTTCCCTCCCTCCTTTTTTCTTTTACCATCAAACTAATCTTATAACTCTTCCATTTTGCTTAAACGTGACTAAGCCTAGAAAATTGAGAAGTCGTCAAGATGGTTATGCAGTGAAATCATCTTTGGAGGCTGAAGATGGAATTTTGTATCCCCTTGAGAAGAACTTCTTCTTTCTTCCTAAACCTCCCACTCTTATTCTTCACAAATCTGATTTATATGATATTTACACCGTGGAGATTTTAATTTGGCATGCTGGTGGTGGTTCCAATATGCATTATTTTGACCTTCTCTTCAGACTAAAATCTGAACAAGAACATCTCTTTCGTAATATTCAGAGAAATGAGTACCACAATTTGTATGAATTTATCAGTTCAAAGGGCTTGAAAATTACAAACTTAGGAGATGCCCAACCTACTGTTGGTATAAAGAAGGTTCTTGAGAATGACGATGATGATGCTGTTGATACACATCTTAAGCACATAAAAATGAAGCTTGCGGAGATGAAAGTGACAAGGAGGATGATGAAGGTTCTCCTACTGATGATTATGGGGCAGGCGATTCTGATGGCAGTGATGATGAGAAAGAGGCAAAAGTCTGCCAAAAAGGAATCAAAGAAGGAATTGCCTTCTAAGACATCTACTTCTAAAAAGAAATCAAAGATGATGAAGATGGACAGAAGAAAAAACAGAAGAAGAAAAAGGACCCAAATGCACCCAAGAGGGCAATGTCTGGTGTGTTCTATTTTGTCATATTGGCTATATGGTTTTGGATTTGGGTGTCTAAGTTGTGGGTGGGAGTATTTATCAGTTGTCACCTCAATTCTGCATAGCTGCCTAGCCTCAGAGTTTGGGGCTACAATTACAATGGCAATTTAA
>Glyma11g21340.1 sequence type=predicted peptide gene model=Glyma11g21340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high YSTYPRTYDLLHALTVFSDIKTRGCNQEDLLIEMHLGNRTRHLSLPPFFFYHQTNLITLPFCLNVTKPRKLRSRQDGYAVKSSLEAEDGILYPLEKNFFFLPKPPTLILHKSDLYDIYTVEILIWHAGGGSNMHYFDLLFRLKSEQEHLFRNIQRNEYHNLYEFISSKGLKITNLGDAQPTVGIKKVLENDDDDAVDTHLKHIKMKLAEMKVTRRMMKVLLLMIMGQAILMAVMMRKRQKSAKKESKKELPSKTSTSKKKSKMMKMDRRKNRRRKRTQMHPRGQCLVCSILSYWLYGFGFGCLSCGWEYLSVVTSILHSCLASEFGATITMAI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
