SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g21340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g21340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g21340

Feature Type:gene_model
Chromosome:Gm11
Start:18347977
stop:18350201
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28730AT Annotation by Michelle Graham. TAIR10: high mobility group | chr3:10784954-10788498 FORWARD LENGTH=646 SoyBaseE_val: 5.00E-50ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0016569GO-bp Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005719GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear euchromatin SoyBaseN/AISS
GO:0035101GO-cc Annotation by Michelle Graham. GO Cellular Compartment: FACT complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF03141PFAM Putative methyltransferase JGI ISS
PF03531PFAM Structure-specific recognition protein (SSRP1) JGI ISS
UniRef100_G7KH07UniRef Annotation by Michelle Graham. Most informative UniRef hit: FACT complex subunit SSRP1 n=1 Tax=Medicago truncatula RepID=G7KH07_MEDTR SoyBaseE_val: 5.00E-62ISS
UniRef100_I1LWI6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LWI6_SOYBN SoyBaseE_val: 2.00E-78ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g21340 not represented in the dataset

Glyma11g21340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g152900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g21340.1   sequence type=CDS   gene model=Glyma11g21340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATTCAACATACCCCCGAACTTATGATTTACTCCATGCATTGACTGTGTTTTCTGACATTAAAACAAGAGGGTGCAATCAAGAGGATCTATTGATTGAGATGCACCTGGGGAATCGAACCCGCCACCTTTCCCTCCCTCCTTTTTTCTTTTACCATCAAACTAATCTTATAACTCTTCCATTTTGCTTAAACGTGACTAAGCCTAGAAAATTGAGAAGTCGTCAAGATGGTTATGCAGTGAAATCATCTTTGGAGGCTGAAGATGGAATTTTGTATCCCCTTGAGAAGAACTTCTTCTTTCTTCCTAAACCTCCCACTCTTATTCTTCACAAATCTGATTTATATGATATTTACACCGTGGAGATTTTAATTTGGCATGCTGGTGGTGGTTCCAATATGCATTATTTTGACCTTCTCTTCAGACTAAAATCTGAACAAGAACATCTCTTTCGTAATATTCAGAGAAATGAGTACCACAATTTGTATGAATTTATCAGTTCAAAGGGCTTGAAAATTACAAACTTAGGAGATGCCCAACCTACTGTTGGTATAAAGAAGGTTCTTGAGAATGACGATGATGATGCTGTTGATACACATCTTAAGCACATAAAAATGAAGCTTGCGGAGATGAAAGTGACAAGGAGGATGATGAAGGTTCTCCTACTGATGATTATGGGGCAGGCGATTCTGATGGCAGTGATGATGAGAAAGAGGCAAAAGTCTGCCAAAAAGGAATCAAAGAAGGAATTGCCTTCTAAGACATCTACTTCTAAAAAGAAATCAAAGATGATGAAGATGGACAGAAGAAAAAACAGAAGAAGAAAAAGGACCCAAATGCACCCAAGAGGGCAATGTCTGGTGTGTTCTATTTTGTCATATTGGCTATATGGTTTTGGATTTGGGTGTCTAAGTTGTGGGTGGGAGTATTTATCAGTTGTCACCTCAATTCTGCATAGCTGCCTAGCCTCAGAGTTTGGGGCTACAATTACAATGGCAATTTAA

>Glyma11g21340.1   sequence type=predicted peptide   gene model=Glyma11g21340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YSTYPRTYDLLHALTVFSDIKTRGCNQEDLLIEMHLGNRTRHLSLPPFFFYHQTNLITLPFCLNVTKPRKLRSRQDGYAVKSSLEAEDGILYPLEKNFFFLPKPPTLILHKSDLYDIYTVEILIWHAGGGSNMHYFDLLFRLKSEQEHLFRNIQRNEYHNLYEFISSKGLKITNLGDAQPTVGIKKVLENDDDDAVDTHLKHIKMKLAEMKVTRRMMKVLLLMIMGQAILMAVMMRKRQKSAKKESKKELPSKTSTSKKKSKMMKMDRRKNRRRKRTQMHPRGQCLVCSILSYWLYGFGFGCLSCGWEYLSVVTSILHSCLASEFGATITMAI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo