SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g20300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g20300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g20300

Feature Type:gene_model
Chromosome:Gm11
Start:17126804
stop:17129629
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08080AT Annotation by Michelle Graham. TAIR10: alpha carbonic anhydrase 7 | chr1:2517022-2518546 REVERSE LENGTH=275 SoyBaseE_val: 1.00E-97ISS
GO:0006730GO-bp Annotation by Michelle Graham. GO Biological Process: one-carbon metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004089GO-mf Annotation by Michelle Graham. GO Molecular Function: carbonate dehydratase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG0382 KOG Carbonic anhydrase JGI ISS
PTHR18952Panther CARBONIC ANHYDRASE JGI ISS
PTHR18952:SF2Panther gb def: similar to carbonic anhydrase va, mitochondrial precursor, carbonic anhydrase v, JGI ISS
PF00194PFAM Eukaryotic-type carbonic anhydrase JGI ISS
UniRef100_B9STU9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carbonic anhydrase, putative n=1 Tax=Ricinus communis RepID=B9STU9_RICCO SoyBaseE_val: 4.00E-99ISS
UniRef100_I1LL36UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LL36_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g20300 not represented in the dataset

Glyma11g20300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g196700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g20300.1   sequence type=CDS   gene model=Glyma11g20300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGCTTGCTAAGCAGGTTTTGTTTTGCAGTTTATTAACTGCACTTGTTTTGCTACCATTCCCGGTAATAATGTCTCATTTAGTTGAGGACGAGAGCGAGTTTAATTATGATGTTAAGAGTAAGAGAGGACCATATAACTGGGGAAACATTAAACCCGAATGGAGTATATGCAAAAATGGATCCATGCAGTCACCGATTAATCTGTTGAATAAGAGGGTTCAAATAGCACCCCATTTGGGAAAACTTCATATCAACTACCAACCATCCAATGCAACTCTTAGGAATAGGGGTCATAATATAATGCTGGAATGGCTTGCTGGCACAAGCTATCTACAAATTAATGAAACTCAGTATGTACTTAAGCAATTCCATTGGCATTCTCCCTCTGAGCACACCATAGATGGCAGAAGGTTTGATCTGGAGTTACACATGGTGCATGAAGCTTCATCCGGAGAAATTGCAGTGATTGGAATGTTGTATAAGGCTGGAAGACCAGACCCTTTATTGTCATTGTTAGGGAATCACATAAAGGCCATTTCTGATTGTACGGGAGCAGAAATAGAATTGGGTGTACTGGATCCTTGGCTGGTTAGCATATGCAGAAGCAGAACACAGTATTACAGATATAGTGGTTCTCTGACTACTCCTCCGTGCACTGAGAATGTTGCTTGGACCGTGCTTACAGAGGTGAGATATGTTTCAAGGGAGCAAATCAGACTGCTTAGAGTTGCCGTTCATGATGATTCAAATGCAAGACCATTGCAACCAATAAACAATCGCTTAGTGAAACTCTATATACCATTGCAGGATTCAAATCGCTTAGTGCAACGTTAG

>Glyma11g20300.1   sequence type=predicted peptide   gene model=Glyma11g20300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLAKQVLFCSLLTALVLLPFPVIMSHLVEDESEFNYDVKSKRGPYNWGNIKPEWSICKNGSMQSPINLLNKRVQIAPHLGKLHINYQPSNATLRNRGHNIMLEWLAGTSYLQINETQYVLKQFHWHSPSEHTIDGRRFDLELHMVHEASSGEIAVIGMLYKAGRPDPLLSLLGNHIKAISDCTGAEIELGVLDPWLVSICRSRTQYYRYSGSLTTPPCTENVAWTVLTEVRYVSREQIRLLRVAVHDDSNARPLQPINNRLVKLYIPLQDSNRLVQR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo