SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g19501

Feature Type:gene_model
Chromosome:Gm11
Start:16243375
stop:16249342
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g19501
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08230AT Annotation by Michelle Graham. TAIR10: Transmembrane amino acid transporter family protein | chr1:2583715-2586700 REVERSE LENGTH=451 SoyBaseE_val: 2.00E-79ISS
GO:0015812GO-bp Annotation by Michelle Graham. GO Biological Process: gamma-aminobutyric acid transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0015185GO-mf Annotation by Michelle Graham. GO Molecular Function: gamma-aminobutyric acid transmembrane transporter activity SoyBaseN/AISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_G7JM49UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lysine histidine transporter n=1 Tax=Medicago truncatula RepID=G7JM49_MEDTR SoyBaseE_val: 6.00E-110ISS
UniRef100_I1LKW5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LKW5_SOYBN SoyBaseE_val: 7.00E-131ISS

Expression Patterns of Glyma11g19501
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g19501 not represented in the dataset
Glyma11g19501 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g19501
ParalogEvidenceComments
Glyma12g08980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g19501 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g189700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g19501
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g19501
>Glyma11g19501.1   sequence type=CDS   gene model=Glyma11g19501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCAAAGGACTATGTGTTTGTTATCTTGTACTAATAGTCACTTTCTTTAGCGTATCTGTATCCGGTTATTGGGCATTTGGTAATGAATCTGAAGGCCTCATCTTAAGCAACTTCGTGGACAATGGGAAGCCTCTGGTGCCCAAGTGGTTTATTTACATGACCAACATTTTGATTATAACACAATTATCTGCGGTTGGTGTGGTTTATTTGCAACCAACAAATGAAGTGCTGGAGCAAACATTTGGAGACCCCAAAAGCCCTGAGTTCTCTAAACCCAATGTAATCCCTAGAGTGATTTCTCGGTCATTAGCTACTACTATTTCAACCACTATAGCAGCCATGCTTCCATTTTTTGGAGACATAAACTCTCTTATAGGAGCATTTGGCTTTATCCCACTTGACTTCATCTTGCCTATGGTTTTCTACAATTTGACATTTAAGCCATCTAAGAGAAGCCCTATTTTCTGGTTGAATGTGACAATCGTTGTGGCTTTCTCCGCATTGGGAGCTATAGCAGCAGTTAGGCAGATAGTTCTTGATGCTAAAAATTACCAATTATTTGCTAATATATGA
Predicted protein sequences of Glyma11g19501
>Glyma11g19501.1   sequence type=predicted peptide   gene model=Glyma11g19501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKGLCVCYLVLIVTFFSVSVSGYWAFGNESEGLILSNFVDNGKPLVPKWFIYMTNILIITQLSAVGVVYLQPTNEVLEQTFGDPKSPEFSKPNVIPRVISRSLATTISTTIAAMLPFFGDINSLIGAFGFIPLDFILPMVFYNLTFKPSKRSPIFWLNVTIVVAFSALGAIAAVRQIVLDAKNYQLFANI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo