Glyma11g19300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g19300

Feature Type:	gene_model
Chromosome:	Gm11
Start:	16002641
stop:	16004779
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g19300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G21105	AT	Annotation by Michelle Graham. TAIR10: cytochrome-c oxidases;electron carriers \| chr4:11266273-11266724 FORWARD LENGTH=68	SoyBase	E_val: 7.00E-37	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0004129	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02238	PFAM	Cytochrome c oxidase subunit VIIa	JGI		ISS
UniRef100_I1LKU8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LKU8_SOYBN	SoyBase	E_val: 2.00E-41	ISS
UniRef100_Q944S8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acytochrome-c oxidase/ electron carrier n=1 Tax=Arabidopsis thaliana RepID=Q944S8_ARATH	SoyBase	E_val: 3.00E-34	ISS

Expression Patterns of Glyma11g19300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g19300

Paralog	Evidence	Comments
Glyma12g09170	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g19300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g187900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g19300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g19300

Limit To All Plant Sequences

>Glyma11g19300.1   sequence type=CDS   gene model=Glyma11g19300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGAATCACCATTCAGACCACGAGAAAAGCTTGCTGAGAAGCAAAAATATTTTCAGAGTATCCACAGGCATACCTACTTGAAGGGACCCATGGATAAGATTACATCCGTGGCCATACCACTGGCTTTGGCTGCAACGTCAATTTACATGATTGGACGAGGGATCTATAATATGTCGCATGGAATTGGAAAGAAAGAATAA

Predicted protein sequences of Glyma11g19300

Limit To All Plant Sequences

>Glyma11g19300.1   sequence type=predicted peptide   gene model=Glyma11g19300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSESPFRPREKLAEKQKYFQSIHRHTYLKGPMDKITSVAIPLALAATSIYMIGRGIYNMSHGIGKKE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain