|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G71830 | AT | Annotation by Michelle Graham. TAIR10: somatic embryogenesis receptor-like kinase 1 | chr1:27018575-27021842 FORWARD LENGTH=625 | SoyBase | E_val: 2.00E-41 | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0009556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microsporogenesis | SoyBase | N/A | ISS |
| GO:0009742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification | SoyBase | N/A | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0010152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen maturation | SoyBase | N/A | ISS |
| GO:0010227 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral organ abscission | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010431 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed maturation | SoyBase | N/A | ISS |
| GO:0016310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phosphorylation | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0045595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation | SoyBase | N/A | ISS |
| GO:0046777 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation | SoyBase | N/A | ISS |
| GO:0051301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell division | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004675 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transmembrane receptor protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0033612 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding | SoyBase | N/A | ISS |
| GO:0042802 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: identical protein binding | SoyBase | N/A | ISS |
| PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24420:SF351 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
| UniRef100_C6ZGA8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Somatic embryogenesis receptor kinase n=2 Tax=Glycine max RepID=C6ZGA8_SOYBN | SoyBase | E_val: 8.00E-41 | ISS |
| UniRef100_I1LD98 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LD98_SOYBN | SoyBase | E_val: 6.00E-41 | ISS |
|
Glyma11g18541 not represented in the dataset |
Glyma11g18541 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g180700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g18541.1 sequence type=CDS gene model=Glyma11g18541 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTATGTTATGAGTTTAATGCAGAGGCAAATCATGATTTGTGTCCCAAGTGTATATATGCGTATGTCCCATCGGTGATACTGATAAAGCGTCCTCCATATGAAGAACCCCTGGATTGGCCAACTCGGAAAAGAGTAGCTTTGGGATCTGCAATGGGTCTTTCATATTTGCATGATCATTGTGACCCAAAGATTATTCATCGTGATGTGAAGGCTGCCAACATATTGCTGGATGAAGAGTTTGAGGCTGTTGTTGGGGACTTTGGATTGGCCAAACTTATGGATTACAAGGACACGGTGAAAATTCAAAAAAACCTGGGGCTGCTCATAATGTTCGACTATATTCAATTGCTTCCACAAGGTATGGGGACTTTTTTGATGGAAAAACTGCCAGCTTGTGTGTGCGTCGTGCTGTTTATTATGATCCTGTGA
>Glyma11g18541.1 sequence type=predicted peptide gene model=Glyma11g18541 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLCYEFNAEANHDLCPKCIYAYVPSVILIKRPPYEEPLDWPTRKRVALGSAMGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTVKIQKNLGLLIMFDYIQLLPQGMGTFLMEKLPACVCVVLFIMIL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||