|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G45980 | AT | Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr3:16897492-16897944 REVERSE LENGTH=150 | SoyBase | E_val: 9.00E-78 | ISS |
GO:0006334 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleosome assembly | SoyBase | N/A | ISS |
GO:0007020 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule nucleation | SoyBase | N/A | ISS |
GO:0000786 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleosome | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
KOG1744 | KOG | Histone H2B | JGI | ISS | |
PTHR23428 | Panther | HISTONE H2B | JGI | ISS | |
PF00125 | PFAM | Core histone H2A/H2B/H3/H4 | JGI | ISS | |
UniRef100_G7JTQ9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone H2B n=1 Tax=Medicago truncatula RepID=G7JTQ9_MEDTR | SoyBase | E_val: 9.00E-85 | ISS |
UniRef100_UPI0001817F98 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0001817F98 related cluster n=1 Tax=unknown RepID=UPI0001817F98 | SoyBase | E_val: 1.00E-95 | ISS |
Glyma11g15070 not represented in the dataset |
Glyma11g15070 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.11g141800 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g15070.1 sequence type=CDS gene model=Glyma11g15070 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCACCAAAGGCGGAGAAGAAGCCCGCAGAGGAGAAGAAGTCCACGGTGGGAGACAAGGCTCCGGCGGAGAAGAAGCCAAAGGCCGGAAAGAAGCTTCCGAAGGAGGGAGGCGCCGGCGGAGAAGGGAAGAAGAAGAAGAGGAACAAGAAGAGCGTGGAGACATACAAGATCTACATCTTCAAGGTTCTGAAGCAGGTTCACCCTGACATTGGTATCTCAAGCAAGGCCATGGGAATCATGAACAGCTTCATCAACGACATCTTCGAGAAGCTTGCCCAGGAATCTTCTAGACTTGCCCGCTACAACAAGAAACCCACCATCACTTCGAGGGAAATTCAGACCGCGGTCAGGCTTGTGCTGCCCGGTGAATTGGCTAAGCACGCCGTCTCTGAGGGTACCAAGGCCGTCACCAAGTTTACTAGCTCTTAA
>Glyma11g15070.1 sequence type=predicted peptide gene model=Glyma11g15070 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAPKAEKKPAEEKKSTVGDKAPAEKKPKAGKKLPKEGGAGGEGKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||