SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g14210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g14210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g14210

Feature Type:gene_model
Chromosome:Gm11
Start:10198469
stop:10202323
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12860AT Annotation by Michelle Graham. TAIR10: dicarboxylate transporter 1 | chr5:4059927-4061919 REVERSE LENGTH=557 SoyBaseE_val: 0ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0015729GO-bp Annotation by Michelle Graham. GO Biological Process: oxaloacetate transport SoyBaseN/AISS
GO:0015742GO-bp Annotation by Michelle Graham. GO Biological Process: alpha-ketoglutarate transport SoyBaseN/AISS
GO:0015743GO-bp Annotation by Michelle Graham. GO Biological Process: malate transport SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0019676GO-bp Annotation by Michelle Graham. GO Biological Process: ammonia assimilation cycle SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0071423GO-bp Annotation by Michelle Graham. GO Biological Process: malate transmembrane transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015131GO-mf Annotation by Michelle Graham. GO Molecular Function: oxaloacetate transmembrane transporter activity SoyBaseN/AISS
GO:0015139GO-mf Annotation by Michelle Graham. GO Molecular Function: alpha-ketoglutarate transmembrane transporter activity SoyBaseN/AISS
GO:0015140GO-mf Annotation by Michelle Graham. GO Molecular Function: malate transmembrane transporter activity SoyBaseN/AISS
GO:0015367GO-mf Annotation by Michelle Graham. GO Molecular Function: oxoglutarate:malate antiporter activity SoyBaseN/AISS
PTHR10283Panther CATION TRANSPORTER RELATED JGI ISS
PTHR10283:SF13Panther gb def: conserved hypothetical protein [thermotoga maritima] JGI ISS
PF00939PFAM Sodium:sulfate symporter transmembrane region JGI ISS
UniRef100_B9RID8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2-oxoglutarate/malate translocator, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9RID8_RICCO SoyBaseE_val: 0ISS
UniRef100_I1LJW4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LJW4_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g14210 not represented in the dataset

Glyma11g14210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g06190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g133800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g14210.1   sequence type=CDS   gene model=Glyma11g14210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCGTAGCACTCACCACCACCGCACTCCCCTACCTCCGCCTCCGCCGCAACACCGCCGCCACCCTCAAACCCAACCGCCACTCTTCCATTTCACTCTCCTCACTCAAACCAACCCTCAACGCTTCAATTTCCTCCTTCCCAAATTTCTCACTAAAAAAACCAAGCCTAGTTTTCAATCAAAAACCCTCCTCTCTAACCGTCAGAGCCTCCGCAGCCTCCATCACTCCGGCGCCGGCGCCTTCATCGGCGCCGGTACAGCCATGGCAAGGCGCTTCCATAAAGCCGCTAATAGCCTCCATCGCGACGGGAGTAATCCTCTGGTTCTCACCCGTTCCCGCCGGCGTGAACCGCAACGCGTGGCAACTGCTCGCGATTTTCTTAGGCACAATCGTCGGCATAATAACACAACCCTTACCTCTTGGAGCGGTAGCAATATTAGGGTTAGGTGTTTCCGTTCTCACCAAAACGCTACCCTTCGCCGCCGCATTCTCCGGCTTCGGCGATCCCATCCCCTGGCTCATCGCCCTCGCTTTCTTCTTCGCCAAGGGTTTTATCAAAACCGGCCTCGGAAACCGCGTCGCGTACCAATTCGTTAAACTCTTCGGCAGCTCCTCGTTAGGGTTAGGTTACAGCTTGGTCTTCAGCGAGGCGCTTCTTGCGCCGGCGATTCCCTCGGTGTCGGCGAGGGCGGGGGGAATTTTCCTGCCGCTGGTGAAGGCGCTGTGCGTGGCTTGCGGGAGCAACGCCGGCGACGGGACGGAGCACAGGTTGGGGGCGTGGCTCATGCTCACGTGCTTTCAGACCTCCGTCATTACGTCGGCGATGTTCTTGACGGCGATGGCGGCGAATCCGCTGTGCGCGACTCTTACTCTGAATTCCATTAATCAAACTATTGGGTGGTTGGATTGGGCTAAAGCCGCAATTGTTCCTGGCTTGGCGTCGTTGGTGTTGGTGCCGTTGATTTTGTATGTTATATATCCGCCGACATTGAAGAGTAGTCCTGATGCTCCTAAGCTTGCGAAGGAGAAGTTGGAGAAGATGGGGCCCATGACGACCAATGAGAAGATCATGACTGCTACTTTGTTTCTCACGGTGGGACTTTGGGTATTTGGAGGGCTTCTTAATGTTGATGCTGTATCTGCTGCAATTCTTGGATTATCTGTACTTCTTGTCACTGGGGTTGTAACATGGAAGGAGTGCTTAGCTGAAGGAGTTGCCTGGGATACCCTCACATGGTTTGCTGCCCTCATAGCAATGGCTGGGTATTTGAACAAATATGGTCTCATTTCTTGGTTCAGTCAAACTGTAGTCAAGTTTGTCGGTGGATTGGGTCTATCATGGCAATTATCTTTTGGAATTCTAGTCCTTCTCTACTTTTACTCTCATTACTTCTTTGCAAGTGGAGCTGCTCATATTGGTGCCATGTTTACTGCATTTTTGTCTGTTGCCACTGCTCTGGGGACTCCGCCATTCTTTGGAGCCATAGTGCTGTCCTTCCTCTCCAACCTTATGGGTGGCCTTACGCATTATGGAATTGGATCAGCTCCTGTGTTTTTCGGTGCCAACTATGTTCCCCTTGCTAAATGGTGGGGCTACGGATTCCTCATTAGTATTGTTAACATTATAATCTGGCTTGGACTTGGAGGAGTTTGGTGGAAATTCATTGGCTTGTGGTAA

>Glyma11g14210.1   sequence type=predicted peptide   gene model=Glyma11g14210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASVALTTTALPYLRLRRNTAATLKPNRHSSISLSSLKPTLNASISSFPNFSLKKPSLVFNQKPSSLTVRASAASITPAPAPSSAPVQPWQGASIKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSVLTKTLPFAAAFSGFGDPIPWLIALAFFFAKGFIKTGLGNRVAYQFVKLFGSSSLGLGYSLVFSEALLAPAIPSVSARAGGIFLPLVKALCVACGSNAGDGTEHRLGAWLMLTCFQTSVITSAMFLTAMAANPLCATLTLNSINQTIGWLDWAKAAIVPGLASLVLVPLILYVIYPPTLKSSPDAPKLAKEKLEKMGPMTTNEKIMTATLFLTVGLWVFGGLLNVDAVSAAILGLSVLLVTGVVTWKECLAEGVAWDTLTWFAALIAMAGYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVATALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLISIVNIIIWLGLGGVWWKFIGLW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo