|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G18080 | AT | Annotation by Michelle Graham. TAIR10: B-S glucosidase 44 | chr3:6191586-6194124 FORWARD LENGTH=512 | SoyBase | E_val: 3.00E-14 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004553 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds | SoyBase | N/A | ISS |
| GO:0004567 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: beta-mannosidase activity | SoyBase | N/A | ISS |
| GO:0008422 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: beta-glucosidase activity | SoyBase | N/A | ISS |
| GO:0043169 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cation binding | SoyBase | N/A | ISS |
| GO:0047668 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: amygdalin beta-glucosidase activity | SoyBase | N/A | ISS |
| GO:0080079 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cellobiose glucosidase activity | SoyBase | N/A | ISS |
| GO:0080081 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 4-methylumbelliferyl-beta-D-glucopyranoside beta-glucosidase activity | SoyBase | N/A | ISS |
| GO:0080082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: esculin beta-glucosidase activity | SoyBase | N/A | ISS |
| GO:0080083 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: beta-gentiobiose beta-glucosidase activity | SoyBase | N/A | ISS |
| UniRef100_G7I6K4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Beta-glucosidase D2 n=1 Tax=Medicago truncatula RepID=G7I6K4_MEDTR | SoyBase | E_val: 7.00E-18 | ISS |
| UniRef100_I1LVG0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LVG0_SOYBN | SoyBase | E_val: 2.00E-24 | ISS |
|
Glyma11g14081 not represented in the dataset |
Glyma11g14081 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g132300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g14081.1 sequence type=CDS gene model=Glyma11g14081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAGAAGTATGCTTTAGGGAATTTGGTGATAGTGTTAAGCACTGGAGGTTATGCAAGTGGTGGATCCCCACCCAATAGACGCTCCAAGTGTTTTGCTAACTGCACTGCTGGTGATTCTACTTCTGAGCCGGTTACACACCACCTCATACTTGCTCATGCTGCAGCGGTAAAAGTCTACAGGGAGAAGTTCCAGAAAACACCTTGGAATAGGATGACATTAATTTGGAGCATAGCCTTTGTACATCCTTTGCACGATAAAATGCAAATTTTATTGCATAAGAGAAATTAA
>Glyma11g14081.1 sequence type=predicted peptide gene model=Glyma11g14081 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQKYALGNLVIVLSTGGYASGGSPPNRRSKCFANCTAGDSTSEPVTHHLILAHAAAVKVYREKFQKTPWNRMTLIWSIAFVHPLHDKMQILLHKRN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||