SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g13645): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g13645): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g13645

Feature Type:gene_model
Chromosome:Gm11
Start:9681834
stop:9683221
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G59410AT Annotation by Michelle Graham. TAIR10: protein kinase family protein | chr3:21950575-21959151 FORWARD LENGTH=1241 SoyBaseE_val: 2.00E-36ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006521GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cellular amino acid metabolic process SoyBaseN/AISS
GO:0018105GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-serine phosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000049GO-mf Annotation by Michelle Graham. GO Molecular Function: tRNA binding SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004694GO-mf Annotation by Michelle Graham. GO Molecular Function: eukaryotic translation initiation factor 2alpha kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PF05773PFAM RWD domain JGI ISS
UniRef100_D7LWD0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Kinase family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LWD0_ARALL SoyBaseE_val: 4.00E-35ISS
UniRef100_UPI000233D76CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D76C related cluster n=1 Tax=unknown RepID=UPI000233D76C SoyBaseE_val: 1.00E-57ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g13645 not represented in the dataset

Glyma11g13645 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g05640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g13645.1   sequence type=CDS   gene model=Glyma11g13645   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGAGAATATGGCACAGCTCGAAGAAGAAAAAGCGCGGCGGCGGCGGGAGCGGTCGCCGGAGCAAGGGAAGAACACAGTCCAAAGATCACGCTTCTCAATTCGGCGCCGACGATTACGATCAGCTCTCCGAAGATATTACCGCATTATGCGCAATTTTCGAAGAAGACTGCAAGGTTCTTCCAGGATCGCCTCCTCGTGTAGTTATTAAGCTCAGCCTTACTAAGGATATGGGTTATGAGGACCTAGACGTTTCTGCTGTTCTTGCTATCAGGTGCTTGCCTGGGTATCCCTTCAAGTGCCCCAAGTTGCAGATTACTCCGGAGAAAGGGTTATCAGAAGCTGATGCTAAAAAGCTTTTGTCGCTCTTCCAAGATCTGGTCTTACTCTTCCGCTGTTGTTAA

>Glyma11g13645.1   sequence type=predicted peptide   gene model=Glyma11g13645   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LRIWHSSKKKKRGGGGSGRRSKGRTQSKDHASQFGADDYDQLSEDITALCAIFEEDCKVLPGSPPRVVIKLSLTKDMGYEDLDVSAVLAIRCLPGYPFKCPKLQITPEKGLSEADAKKLLSLFQDLVLLFRCC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo