Glyma11g13320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g13320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g13320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g13320

Feature Type:	gene_model
Chromosome:	Gm11
Start:	9458268
stop:	9462213
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g13320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G43560	AT	Annotation by Michelle Graham. TAIR10: FKBP-like peptidyl-prolyl cis-trans isomerase family protein \| chr2:18073995-18075385 REVERSE LENGTH=223	SoyBase	E_val: 6.00E-102	ISS
GO:0000413	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein peptidyl-prolyl isomerization	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0018208	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0031977	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen	SoyBase	N/A	ISS
GO:0003755	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity	SoyBase	N/A	ISS
GO:0005528	GO-mf	Annotation by Michelle Graham. GO Molecular Function: FK506 binding	SoyBase	N/A	ISS
KOG0544	KOG	FKBP-type peptidyl-prolyl cis-trans isomerase	JGI		ISS
KOG0552	KOG	FKBP-type peptidyl-prolyl cis-trans isomerase	JGI		ISS
PTHR10516	Panther	FK506 BINDING PROTEIN	JGI		ISS
PTHR10516:SF15	Panther	FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	JGI		ISS
PF00254	PFAM	FKBP-type peptidyl-prolyl cis-trans isomerase	JGI		ISS
UniRef100_I1LJL8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1LJL8_SOYBN	SoyBase	E_val: 4.00E-164	ISS
UniRef100_I1LJL8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1LJL8_SOYBN	SoyBase	E_val: 4.00E-164	ISS

Expression Patterns of Glyma11g13320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g13320 not represented in the dataset	Glyma11g13320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g13320

Paralog	Evidence	Comments
Glyma12g05340	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g13320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g124900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g13320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma11g13320

Limit To All Plant Sequences

>Glyma11g13320.2   sequence type=transcript   gene model=Glyma11g13320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTTCTATCTGCCACGTGGTAGGTACAAACACTTGCTCCAGCTCCAAACCATGTTTGAGAAGATTCAGTTTATCCATTTTGCGGACATCATCACATGACATCCTTGGTTATGCCTACCATGGCCTCCTCTCTGCTTCTCCAACTTGGTTCTACTTGTGGTAAAAGTCCCTCTTTTGCTCCTCCTCAAAGCATTTTGGTTGACAAACTTCGAAGATTAGTGATTAAAGTCAAGTCCTCAGAGACAAGGGAATGCACCACAGCTATGTTTAATGCCAATTCACGTAGAGACTTTCTTGGGTTAGCTTTAGGAGTCTCGGGTCTCTTCATCGGTTCGCTGGATGCAAATGGAGCTGGTTTGCCCCCAGAGGAAAAGCCTAAACTGTGTGATGACACTTGTGAGAAAGAGCTTGAAAATGTGCCTACGGTAACTACTGGATCAGGTTTGCAATACAAGGATATTAAAGTTGGACAAGGTCCTAGTCCACCAATTGGATTTCAGGTGGCTGCTAATTATGTTGCAATGGTTCCCTCCGGACAAATATTTGATAGTTCACTGGAGAAAGGTCAGCCTTATATTTTTCGTGTTGGTTCTGGTCAGGTGATACAAGGACTTGATGAAGGTATTCTGAGCATGAAAGTAGGAGGGAAACGTCGACTGTACATACCCGGATCAGTAAGCTTCTTTCTTGATAGCTGATGCTAGATTCCCCATGTCTGGCATTCCCAAAAGGCCTTACTTCTGCTCCTGGAAGACCAAGGGTGGCTCCAAGCAGTCCAGTCATATTTGATGTTAGTTTGGAATACATACCGGGGCTTGAAGTGGATGAGGAATAAAATGAGTTTGTCCATTCTAGCTTTAATTGTAGTACCTAATCAATCTTGTATCTTAATTTTGTTTGTCACTGGCACCATCACCATTCTATACGATCGTTAATTCTTTTTGAGAAATTCGCAAAAATCTCCTAGCTATGTTGAGTAACATTGTTCTGACTTCTGAGTTCAAATATCACGAAAAAATTTCCTTATGTTTCTACTTAATGG

Coding sequences of Glyma11g13320

Limit To All Plant Sequences

>Glyma11g13320.1   sequence type=CDS   gene model=Glyma11g13320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATCCTTGGTTATGCCTACCATGGCCTCCTCTCTGCTTCTCCAACTTGGTTCTACTTGTGGTAAAAGTCCCTCTTTTGCTCCTCCTCAAAGCATTTTGGTTGACAAACTTCGAAGATTAGTGATTAAAGTCAAGTCCTCAGAGACAAGGGAATGCACCACAGCTATGTTTAATGCCAATTCACGTAGAGACTTTCTTGGGTTAGCTTTAGGAGTCTCGGGTCTCTTCATCGGTTCGCTGGATGCAAATGGAGCTGGTTTGCCCCCAGAGGAAAAGCCTAAACTGTGTGATGACACTTGTGAGAAAGAGCTTGAAAATGTGCCTACGGTAACTACTGGATCAGGTTTGCAATACAAGGATATTAAAGTTGGACAAGGTCCTAGTCCACCAATTGGATTTCAGGTGGCTGCTAATTATGTTGCAATGGTTCCCTCCGGACAAATATTTGATAGTTCACTGGAGAAAGGTCAGCCTTATATTTTTCGTGTTGGTTCTGGTCAGGTGATACAAGGACTTGATGAAGGTATTCTGAGCATGAAAGTAGGAGGGAAACGTCGACTGTACATACCCGGATCACTGGCATTCCCAAAAGGCCTTACTTCTGCTCCTGGAAGACCAAGGGTGGCTCCAAGCAGTCCAGTCATATTTGATGTTAGTTTGGAATACATACCGGGGCTTGAAGTGGATGAGGAATAA

>Glyma11g13320.2   sequence type=CDS   gene model=Glyma11g13320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATCCTTGGTTATGCCTACCATGGCCTCCTCTCTGCTTCTCCAACTTGGTTCTACTTGTGGTAAAAGTCCCTCTTTTGCTCCTCCTCAAAGCATTTTGGTTGACAAACTTCGAAGATTAGTGATTAAAGTCAAGTCCTCAGAGACAAGGGAATGCACCACAGCTATGTTTAATGCCAATTCACGTAGAGACTTTCTTGGGTTAGCTTTAGGAGTCTCGGGTCTCTTCATCGGTTCGCTGGATGCAAATGGAGCTGGTTTGCCCCCAGAGGAAAAGCCTAAACTGTGTGATGACACTTGTGAGAAAGAGCTTGAAAATGTGCCTACGGTAACTACTGGATCAGGTTTGCAATACAAGGATATTAAAGTTGGACAAGGTCCTAGTCCACCAATTGGATTTCAGGTGGCTGCTAATTATGTTGCAATGGTTCCCTCCGGACAAATATTTGATAGTTCACTGGAGAAAGGTCAGCCTTATATTTTTCGTGTTGGTTCTGGTCAGGTGATACAAGGACTTGATGAAGGTATTCTGAGCATGAAAGTAGGAGGGAAACGTCGACTGTACATACCCGGATCAGTAAGCTTCTTTCTTGATAGCTGA

Predicted protein sequences of Glyma11g13320

Limit To All Plant Sequences

>Glyma11g13320.1   sequence type=predicted peptide   gene model=Glyma11g13320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSLVMPTMASSLLLQLGSTCGKSPSFAPPQSILVDKLRRLVIKVKSSETRECTTAMFNANSRRDFLGLALGVSGLFIGSLDANGAGLPPEEKPKLCDDTCEKELENVPTVTTGSGLQYKDIKVGQGPSPPIGFQVAANYVAMVPSGQIFDSSLEKGQPYIFRVGSGQVIQGLDEGILSMKVGGKRRLYIPGSLAFPKGLTSAPGRPRVAPSSPVIFDVSLEYIPGLEVDEE*

>Glyma11g13320.2   sequence type=predicted peptide   gene model=Glyma11g13320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSLVMPTMASSLLLQLGSTCGKSPSFAPPQSILVDKLRRLVIKVKSSETRECTTAMFNANSRRDFLGLALGVSGLFIGSLDANGAGLPPEEKPKLCDDTCEKELENVPTVTTGSGLQYKDIKVGQGPSPPIGFQVAANYVAMVPSGQIFDSSLEKGQPYIFRVGSGQVIQGLDEGILSMKVGGKRRLYIPGSVSFFLDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain