SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g12980

Feature Type:gene_model
Chromosome:Gm11
Start:9275328
stop:9276819
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g12980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G16060AT Annotation by Michelle Graham. TAIR10: hemoglobin 1 | chr2:6982782-6983522 REVERSE LENGTH=160 SoyBaseE_val: 2.00E-83ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0015671GO-bp Annotation by Michelle Graham. GO Biological Process: oxygen transport SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR22924Panther LEGHEMOGLOBIN JGI ISS
PTHR22924:SF4Panther NON-SYMBIOTIC HEMOGLOBIN (RHB) JGI ISS
PF00042PFAM Globin JGI ISS
UniRef100_Q42785UniRef Annotation by Michelle Graham. Best UniRef hit: Nonsymbiotic hemoglobin n=3 Tax=Glycine max RepID=Q42785_SOYBN SoyBaseE_val: 8.00E-114ISS
UniRef100_Q42785UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nonsymbiotic hemoglobin n=3 Tax=Glycine max RepID=Q42785_SOYBN SoyBaseE_val: 8.00E-114ISS

Expression Patterns of Glyma11g12980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g12980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g121800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g12980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g12980
>Glyma11g12980.1   sequence type=CDS   gene model=Glyma11g12980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCACCACATTGGAAAGAGGTTTCTCGGAAGAGCAAGAAGCTCTGGTGGTGAAGTCATGGAATGTCATGAAGAAGAATTCTGGAGAGTTGGGTCTCAAGTTTTTCTTGAAAATATTTGAGATTGCTCCATCAGCTCAGAAATTGTTCTCATTCTTGAGAGATTCAACGGTTCCTTTGGAGCAAAATCCCAAGCTCAAGCCCCATGCCGTGTCTGTCTTTGTAATGACCTGTGATTCAGCAGTTCAGCTGCGGAAGGCCGGGAAAGTCACTGTCAGAGAATCAAACTTGAAAAAATTAGGTGCTACCCATTTTAGAACCGGCGTAGCAAACGAGCATTTCGAGGTGACAAAGTTTGCACTGTTGGAGACCATAAAAGAAGCTGTACCAGAAATGTGGTCACCGGCTATGAAGAATGCATGGGGAGAAGCTTATGATCAGCTGGTCGATGCCATTAAATCTGAAATGAAACCACCCTCCTCTTAG
Predicted protein sequences of Glyma11g12980
>Glyma11g12980.1   sequence type=predicted peptide   gene model=Glyma11g12980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTTLERGFSEEQEALVVKSWNVMKKNSGELGLKFFLKIFEIAPSAQKLFSFLRDSTVPLEQNPKLKPHAVSVFVMTCDSAVQLRKAGKVTVRESNLKKLGATHFRTGVANEHFEVTKFALLETIKEAVPEMWSPAMKNAWGEAYDQLVDAIKSEMKPPSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo