SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g12600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g12600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g12600

Feature Type:gene_model
Chromosome:Gm11
Start:8983317
stop:8988045
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34460AT Annotation by Michelle Graham. TAIR10: GTP binding protein beta 1 | chr4:16477393-16479266 REVERSE LENGTH=377 SoyBaseE_val: 0ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009788GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009991GO-bp Annotation by Michelle Graham. GO Biological Process: response to extracellular stimulus SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0072593GO-bp Annotation by Michelle Graham. GO Biological Process: reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0286 KOG G-protein beta subunit JGI ISS
PTHR19850Panther GUANINE NUCLEOTIDE-BINDING PROTEIN BETA (G PROTEIN BETA) JGI ISS
PTHR19850:SF3Panther GUANINE NUCLEOTIDE-BINDING PROTEIN BETA 2 (G PROTEIN BETA2) JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_G7J6K3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Guanine nucleotide-binding protein subunit beta-1 n=1 Tax=Medicago truncatula RepID=G7J6K3_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1LJE1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LJE1_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g12600 not represented in the dataset

Glyma11g12600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g04810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g118500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g12600.1   sequence type=CDS   gene model=Glyma11g12600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGTTACGGAGCTCAAGGAGCGTCACTCTGCTGCCACCGACACCGTCAACAATCTCAGACACCGTTTAAAGCAGAAGCGCCTTTCGTTGCTCGACACAGATATTTCTGGGTATGCAAGGTCTCAGGGTAGAACGCCTGTGACCTTTGGACCTACGGATCTGGTTTGCTGTAGAACCTTGCAGGGTCACACGGGAAAGGTGTATTCATTGGATTGGACTTCTGAAAAAAGTCAGATTGTTAGTGCATCTCAAGATGGGCGATTAATAGTGTGGAATGCTCTAACTAGGCAGAAAATTCATGCCATAAAGCTACCTTGTGCATGGGTCATGACCTGTGCTTTTTCACCAACTGGTCAGTCTGTTGCATGTGGTGGTCTGGACAGTGTTTGTTCTATTTTCAATCTTAATTCGCCAACTGACAAGGATGGGAATCTACCTGTTTCCCGGATGCTTAGTGGACATAAGGGGTATGTTTCCTCTTGTCAGTATGTTCCAGATGAAGATACTCATTTAATTACTGGTTCTGGTGATCAGACATGTGTTTTATGGGATATTACTACTGGCCTTAAAACATCTGTCTTTGGAGGAGAGTTTCAGTCTGGACATACTGCAGATGTACTTAGTATCTCCATTAATGGATCCAACTCGAGAATGTTTGTATCTGGTTCTTGTGATGCAACTGCTCGATTGTGGGATACTCGCGTGGCAAGTCGAGCAGTGCGGACATTTCATGGGCATGAGGGAGATGTTAATGCAGTCAAATTCTTTCCTGATGGAAATAGATTTGGAACTGGTTCAGATGATGGAACCTGCAGATTATTTGACATTAGGACTGGGCACCAACTTCAAGTTTATTATCAGCAGCACAGTGACAATGAGATCCCACCTGTGACTTCCATTGCATTCTCCGCTTCAGGAAGACTTCTCTTTGCTGGATACACAAATGGAGATTGCTATGTCTGGGACACTTTATTGGCAAAGGTGGTACTGAATATAGGATCTCTCCAAGACTCTCATGAGGACAGGATCAGCTGTTTAGGTTTGTCAGCTGATGGAAGTGCCTTGTGTACAGGAAGTTGGGACACAAACTTAAAGATATGGGCGTTTGGAGGGCATAGGAGGACAACTTAA

>Glyma11g12600.1   sequence type=predicted peptide   gene model=Glyma11g12600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVTELKERHSAATDTVNNLRHRLKQKRLSLLDTDISGYARSQGRTPVTFGPTDLVCCRTLQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLKTSVFGGEFQSGHTADVLSISINGSNSRMFVSGSCDATARLWDTRVASRAVRTFHGHEGDVNAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQQHSDNEIPPVTSIAFSASGRLLFAGYTNGDCYVWDTLLAKVVLNIGSLQDSHEDRISCLGLSADGSALCTGSWDTNLKIWAFGGHRRTT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo