|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G21660 | AT | Annotation by Michelle Graham. TAIR10: cold, circadian rhythm, and rna binding 2 | chr2:9265477-9266316 REVERSE LENGTH=159 | SoyBase | E_val: 4.00E-45 | ISS |
| GO:0000380 | GO-bp | Annotation by Michelle Graham. GO Biological Process: alternative mRNA splicing, via spliceosome | SoyBase | N/A | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006406 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus | SoyBase | N/A | ISS |
| GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
| GO:0006970 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to osmotic stress | SoyBase | N/A | ISS |
| GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0007623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: circadian rhythm | SoyBase | N/A | ISS |
| GO:0009266 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0010043 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to zinc ion | SoyBase | N/A | ISS |
| GO:0010119 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010501 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA secondary structure unwinding | SoyBase | N/A | ISS |
| GO:0032508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA duplex unwinding | SoyBase | N/A | ISS |
| GO:0045087 | GO-bp | Annotation by Michelle Graham. GO Biological Process: innate immune response | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005777 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: peroxisome | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0003690 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding | SoyBase | N/A | ISS |
| GO:0003697 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003729 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: mRNA binding | SoyBase | N/A | ISS |
| PTHR24012 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24012:SF31 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_I1LJD0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LJD0_SOYBN | SoyBase | E_val: 1.00E-91 | ISS |
| UniRef100_Q9SWA8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA-binding protein n=1 Tax=Glycine max RepID=Q9SWA8_SOYBN | SoyBase | E_val: 4.00E-47 | ISS |
|
Glyma11g12490 not represented in the dataset |
Glyma11g12490 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g117500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g12490.1 sequence type=CDS gene model=Glyma11g12490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTTCTGCATATGTTGAGTACCGTTGCTTTGTTGGTGGGCTCGCTTGGGCCACAGACGATCATGCCTTGGAGAAAGCCTTCTCTCACTACGGCAACATCGTTGAATCGAAGATTATCAACGATCGTGAGACCGGAAGGTCCAGGGGATTTGGATTTGTTACCTTCGCCTCGGAGAATTCAATGAAGGATGCGATCGAAGGGATGAACGGTCAGAACCTTGACGGACGTAACATAACTGTGAACGAAGCTCAGTCCCGCGGCAGCCGCGGTGGATACGGTGGTCGTCGTGAAGGTGGATATAACCGTGGTGGTGGAGGCTATGGAGGGGGTGGTTATGGTGGTGACAGAGATTGTGGTTACGGTGACGGTGGTTCACGCTACTCTCGTGGTGGCGATGTCAATGGAAGCCGGAGAAACTAG
>Glyma11g12490.1 sequence type=predicted peptide gene model=Glyma11g12490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASAYVEYRCFVGGLAWATDDHALEKAFSHYGNIVESKIINDRETGRSRGFGFVTFASENSMKDAIEGMNGQNLDGRNITVNEAQSRGSRGGYGGRREGGYNRGGGGYGGGGYGGDRDCGYGDGGSRYSRGGDVNGSRRN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||