SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G21580 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein S25 family protein | chr2:9236629-9237510 FORWARD LENGTH=108 | SoyBase | E_val: 3.00E-52 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG1767 | KOG | 40S ribosomal protein S25 | JGI | ISS | |
| PTHR12850 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR12850:SF8 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF03297 | PFAM | S25 ribosomal protein | JGI | ISS | |
| UniRef100_B0BLI2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: CM0216.350.nc protein (Fragment) n=1 Tax=Lotus japonicus RepID=B0BLI2_LOTJA | SoyBase | E_val: 5.00E-68 | ISS |
| UniRef100_I1LJB4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LJB4_SOYBN | SoyBase | E_val: 2.00E-68 | ISS |
|
Glyma11g12300 not represented in the dataset |
Glyma11g12300 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma12g04510 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g115400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g12300.1 sequence type=CDS gene model=Glyma11g12300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGGACAAGGCTCCACCACCTTCCTCCAAGCCCGCCAAATCTGGCGGTGGCAAGCAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAAAGGAGAAGGTGAATAACATGGTGCTGTTTGATCAGGGCACCTATGATAAGCTCCTTTCTGAAGCTCCCAAATTCAAGCTCATCACTCCTTCCATTCTTTCTGATCGTTTGAGGATTAATGGATCACTTGCAAGGAAGGCTATAAGAGAATTGATGGCTAGGGGTTCAATCAGGATGGTGTCTGCCCATGCAAGCCAGCAAATTTACACCAGGGCAACAAACACCTAG
>Glyma11g12300.1 sequence type=predicted peptide gene model=Glyma11g12300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQGTYDKLLSEAPKFKLITPSILSDRLRINGSLARKAIRELMARGSIRMVSAHASQQIYTRATNT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
