Glyma11g12210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g12210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g12210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g12210

Feature Type:	gene_model
Chromosome:	Gm11
Start:	8716866
stop:	8720092
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g12210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08560	AT	Annotation by Michelle Graham. TAIR10: vacuolar H+-ATPase subunit E isoform 2 \| chr3:2600130-2601907 FORWARD LENGTH=235	SoyBase	E_val: 4.00E-116	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005753	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0033178	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, catalytic domain	SoyBase	N/A	ISS
GO:0008553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism	SoyBase	N/A	ISS
GO:0046961	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism	SoyBase	N/A	ISS
KOG1664	KOG	Vacuolar H+-ATPase V1 sector, subunit E	JGI		ISS
PTHR11583	Panther	VACUOLAR ATP SYNTHASE SUBUNIT E	JGI		ISS
PF01991	PFAM	ATP synthase (E/31 kDa) subunit	JGI		ISS
UniRef100_B3TLU2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar ATP synthase subunit E n=1 Tax=Elaeis guineensis RepID=B3TLU2_ELAGV	SoyBase	E_val: 2.00E-120	ISS
UniRef100_UPI000233C3FB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C3FB related cluster n=1 Tax=unknown RepID=UPI000233C3FB	SoyBase	E_val: 7.00E-160	ISS

Expression Patterns of Glyma11g12210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g12210 not represented in the dataset	Glyma11g12210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g12210

Paralog	Evidence	Comments
Glyma12g04410	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g12210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g114400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g12210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g12210

Limit To All Plant Sequences

>Glyma11g12210.1   sequence type=CDS   gene model=Glyma11g12210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGACGCAGATGTGTCAAGGCAGATCCAGCAGATGATCAGGTTCATCCGTCAAGAGGCTGAAGAGAAAGCTAATGAAATATCTGTTGCTGCTGAAGAGGAATTCAATATTGAGAAACTGCAATTGCTAGAAGCTGAAAAAAGAAAGATCAGGCAAGAATACGAACGAAAAGCCAAACAAATTGACGTTAGAAGAAAGATTGAATACTCAACACAGCTGAATGCAGCCCGAATAAAAGTGCTTCAAGCACAAGATGACGCGATGGGTTCTATGAAGGACGCTGCTAAAAAGGGGCTTTTACGTGTCTCAAATGACAAGAAAGTATACAAGAAACTCCTCAAAGACATGATTGTTCAGGGTTTACTACGCTTGAGGGAACCATCAGTGTTATTAAGATGCAGAGAGAGTGACCGTAAGCTAGTTGAGTCATTGATAGAGGAAGCCAAAAAAGAATACTCAGAGAAAGCCAGTATGCAATCCCCTAAGATTTCCCTTGATGATCGTGTTTACCTCCCACCACCGCCTAAGAACGGCGCCGTTGATTCCCATGAACCTTATTGCTCTGGAGGAGTAGTATTGGCCTCGGAGGATGGGAAGATTGTGTTGGAAAACACCCTTGATGCACGGCTTGATGTCATTTTCCGGCAGAAACTGCCTGAGGTAAGGAAGCGCCTGTTAGGTTGA

Predicted protein sequences of Glyma11g12210

Limit To All Plant Sequences

>Glyma11g12210.1   sequence type=predicted peptide   gene model=Glyma11g12210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDADVSRQIQQMIRFIRQEAEEKANEISVAAEEEFNIEKLQLLEAEKRKIRQEYERKAKQIDVRRKIEYSTQLNAARIKVLQAQDDAMGSMKDAAKKGLLRVSNDKKVYKKLLKDMIVQGLLRLREPSVLLRCRESDRKLVESLIEEAKKEYSEKASMQSPKISLDDRVYLPPPPKNGAVDSHEPYCSGGVVLASEDGKIVLENTLDARLDVIFRQKLPEVRKRLLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain