Glyma11g10560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g10560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g10560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g10560

Feature Type:	gene_model
Chromosome:	Gm11
Start:	7533162
stop:	7534205
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g10560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08290	AT	Annotation by Michelle Graham. TAIR10: mRNA splicing factor, thioredoxin-like U5 snRNP \| chr5:2666043-2666936 FORWARD LENGTH=142	SoyBase	E_val: 2.00E-68	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0007033	GO-bp	Annotation by Michelle Graham. GO Biological Process: vacuole organization	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005681	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: spliceosomal complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
KOG3414	KOG	Component of the U4/U6.U5 snRNP/mitosis protein DIM1	JGI		ISS
PTHR12052	Panther	MITOSIS PROTEIN DIM1	JGI		ISS
PF02966	PFAM	Mitosis protein DIM1	JGI		ISS
UniRef100_G7JPJ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin-like 4A n=1 Tax=Medicago truncatula RepID=G7JPJ1_MEDTR	SoyBase	E_val: 6.00E-66	ISS
UniRef100_I1LIR3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIR3_SOYBN	SoyBase	E_val: 9.00E-81	ISS

Expression Patterns of Glyma11g10560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g10560 not represented in the dataset	Glyma11g10560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g10560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g099400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g10560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g10560

Limit To All Plant Sequences

>Glyma11g10560.1   sequence type=CDS   gene model=Glyma11g10560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAATTGAATTGCTGAACACGGAGCCTTTTATGTCGAATAAGATGGATGAAGTGCTGGCATCGGTTGCTGAAAAGATAAAAAACTTCGCAGTGATTTATCTTGTGGATATCACTGAGGTGCCGGATTTCAACACCATGTACGAGTTGTATGAGCCGTGCACCGTTATGTTCTTTTTTAGGAACAAGCATATTATGATAGACCTTGGAACCGGAAACAACAATAAGATCAATTGGGCACTCAAAGACAAGCAAGAGTTCATTGATATTGTCGAAACAGTGTACCGTGGTGCAAGGAAGGGACGTGGTCTAGTCATTTCTCCCAAAGATTACTCTACCAAGTACCGCTACTGA

Predicted protein sequences of Glyma11g10560

Limit To All Plant Sequences

>Glyma11g10560.1   sequence type=predicted peptide   gene model=Glyma11g10560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPIELLNTEPFMSNKMDEVLASVAEKIKNFAVIYLVDITEVPDFNTMYELYEPCTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVISPKDYSTKYRY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain