SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g10490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g10490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g10490

Feature Type:gene_model
Chromosome:Gm11
Start:7497883
stop:7501606
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16870AT Annotation by Michelle Graham. TAIR10: Peptidyl-tRNA hydrolase II (PTH2) family protein | chr5:5546975-5548542 REVERSE LENGTH=169 SoyBaseE_val: 1.00E-87ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004045GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA hydrolase activity SoyBaseN/AISS
KOG3282 KOG Uncharacterized conserved protein JGI ISS
PTHR12649Panther PEPTIDYL-TRNA HYDROLASE 2 JGI ISS
PTHR12649:SF6Panther UNCHARACTERIZED JGI ISS
PF01981PFAM Peptidyl-tRNA hydrolase PTH2 JGI ISS
UniRef100_G7JPK0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-tRNA hydrolase n=1 Tax=Medicago truncatula RepID=G7JPK0_MEDTR SoyBaseE_val: 6.00E-101ISS
UniRef100_I1LIQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIQ7_SOYBN SoyBaseE_val: 8.00E-136ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g10490 not represented in the dataset

Glyma11g10490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g02800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g098800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g10490.1   sequence type=CDS   gene model=Glyma11g10490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTTGACATGGTTGAGTGCCATCCTGGTGGGGGCTGGTTACCTTGCTTTGGGTTACTTCATTGGTTCTCAGTATCCCCCTCGTTTCCTCTTCTCACATAAATTATCGACTAAACATAAAGAAGATGCTTCACTTCTCAATGACAACGACAATAAGAAGAGGAATACTAAGTCCAAACTCAAAGACCCCCTGGAGATTGAACAACTCGCTGAAATCCTCGATGATTTTAAGATGATACTCGTTGTCAGGAATGATCTTAAAATGGGTAAAGGGAAGATTGCTGCTCAATGCAGTCATGCAACGTTAGGTCTCTATAAAAAGATCCTTCGTCGAGCACCAAAGGCTTTGAATAGGTGGGAGATGTCTGCACAGCCTAAGGTGGTTGTCAAAATTGAAAGCGAAGAAGATATGCTGGCTTTGCAAGAAAGGGCTAAATCTCTGAAGTTACCTACCCATATCACAATTGACGCTGGGAGAACACAGATTGCACCAAATTCCAGAACAGTGATGGCAATTCTTGGACCTGTTGAAGTGGTAGATGAGGTAACAGGTGGTCTGAAACTACTATAG

>Glyma11g10490.1   sequence type=predicted peptide   gene model=Glyma11g10490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLTWLSAILVGAGYLALGYFIGSQYPPRFLFSHKLSTKHKEDASLLNDNDNKKRNTKSKLKDPLEIEQLAEILDDFKMILVVRNDLKMGKGKIAAQCSHATLGLYKKILRRAPKALNRWEMSAQPKVVVKIESEEDMLALQERAKSLKLPTHITIDAGRTQIAPNSRTVMAILGPVEVVDEVTGGLKLL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo