SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g10460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g10460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g10460

Feature Type:gene_model
Chromosome:Gm11
Start:7473729
stop:7474752
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g10460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38770AT Annotation by Michelle Graham. TAIR10: proline-rich protein 4 | chr4:18097009-18098448 REVERSE LENGTH=448 SoyBaseE_val: 2.00E-29ISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_Q9M6T7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proline-rich protein n=1 Tax=Nicotiana glauca RepID=Q9M6T7_NICGL SoyBaseE_val: 2.00E-47ISS
UniRef100_UPI000233D86BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D86B related cluster n=1 Tax=unknown RepID=UPI000233D86B SoyBaseE_val: 3.00E-113ISS

Expression Patterns of Glyma11g10460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g10460 not represented in the dataset
Glyma11g10460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g10460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g098500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g10460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g10460
>Glyma11g10460.2   sequence type=CDS   gene model=Glyma11g10460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATTTTAACGCGGCGCCAAGGAGCATTTTTGTGCTTCTGGTTGTCTGTGCTTTTTGTGGTAGTAGACTTTTGCTATGGTGACCATAGTACAGTCGAGGTAGTAGGGTTGGGAGAATGCGCAGATTGCAAGGAGAAAAACATTCAAACTAGCCAGGCTTTCTCAGGTTTACGTGTGACAGTAGACTGCAAGGCAGCAAGTGGAAACTTTGAAAGGAGAGGGGTCGGTGAGCTTGATGAATATGGAAACTTCAAAGTTTCCCTTCCTCATGACACTGTAAAAGACGATAAACTGATAGAAGAATGCTATGCTCAGCTACTTAGTGCATCAGCTGCACCTTGTCCTACCCATGATGGCCCATTGAGCCACAAAATAGTGATAAAGTCAAAAACTAATAATGAGAAACACACCCTTGGTCCTGCTGGGAAACTCAAGTTTTCATCACAAACATGTGCTTCAGCCTCTTCTGGA
Predicted protein sequences of Glyma11g10460
>Glyma11g10460.2   sequence type=predicted peptide   gene model=Glyma11g10460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQILTRRQGAFLCFWLSVLFVVVDFCYGDHSTVEVVGLGECADCKEKNIQTSQAFSGLRVTVDCKAASGNFERRGVGELDEYGNFKVSLPHDTVKDDKLIEECYAQLLSASAAPCPTHDGPLSHKIVIKSKTNNEKHTLGPAGKLKFSSQTCASASSG






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo