Report for Sequence Feature Glyma11g10290
Feature Type: gene_model
Chromosome: Gm11
Start: 7398497
stop: 7399087
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g10290
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G22100 AT
Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr3:7783711-7784469 REVERSE LENGTH=252
SoyBase E_val: 4.00E-10 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
UniRef100_G7IKN0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH117 n=1 Tax=Medicago truncatula RepID=G7IKN0_MEDTR
SoyBase E_val: 2.00E-15 ISS
UniRef100_I1LU89 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LU89_SOYBN
SoyBase E_val: 3.00E-16 ISS
Expression Patterns of Glyma11g10290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma11g10290 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma11g10290
Coding sequences of Glyma11g10290
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g10290.1 sequence type=CDS gene model=Glyma11g10290 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGGGTTTTGAATCCTACACTCCTTGTAGTGTGCACCTTCCCTTTCACCCAATACCGAGCCCTTCAACTTCTTCCCTCAATACCACCACCGCCTCCCTCCCCTTTGCTAGCCGGAGCAGAAGCGGCAGCCCGTGGAGTCGCAGTGTCCTCTGCGAGAAAATGCGGTGTCTCTTGAAGCTGATGCCGTGGGAGAAGAAAATGGACCAGGCGACGCTTCTGGAAGAAAACTACAAATACGTGAAGTTCCTCCAGGCACAGTCACGCGTCCTCCACTCCATTCCCACACCCCAGGCCCTGCAGGTGCTAGAGAACTCCCTCGTGGCCCAAACCATGTGGGGATTTTCATATTTGGAAATAACTATTTCACAATAA
Predicted protein sequences of Glyma11g10290
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g10290.1 sequence type=predicted peptide gene model=Glyma11g10290 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLGFESYTPCSVHLPFHPIPSPSTSSLNTTTASLPFASRSRSGSPWSRSVLCEKMRCLLKLMPWEKKMDQATLLEENYKYVKFLQAQSRVLHSIPTPQALQVLENSLVAQTMWGFSYLEITISQ*