SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g10290

Feature Type:gene_model
Chromosome:Gm11
Start:7398497
stop:7399087
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22100AT Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr3:7783711-7784469 REVERSE LENGTH=252 SoyBaseE_val: 4.00E-10ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
UniRef100_G7IKN0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH117 n=1 Tax=Medicago truncatula RepID=G7IKN0_MEDTR SoyBaseE_val: 2.00E-15ISS
UniRef100_I1LU89UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LU89_SOYBN SoyBaseE_val: 3.00E-16ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g10290.1   sequence type=CDS   gene model=Glyma11g10290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGGTTTTGAATCCTACACTCCTTGTAGTGTGCACCTTCCCTTTCACCCAATACCGAGCCCTTCAACTTCTTCCCTCAATACCACCACCGCCTCCCTCCCCTTTGCTAGCCGGAGCAGAAGCGGCAGCCCGTGGAGTCGCAGTGTCCTCTGCGAGAAAATGCGGTGTCTCTTGAAGCTGATGCCGTGGGAGAAGAAAATGGACCAGGCGACGCTTCTGGAAGAAAACTACAAATACGTGAAGTTCCTCCAGGCACAGTCACGCGTCCTCCACTCCATTCCCACACCCCAGGCCCTGCAGGTGCTAGAGAACTCCCTCGTGGCCCAAACCATGTGGGGATTTTCATATTTGGAAATAACTATTTCACAATAA

>Glyma11g10290.1   sequence type=predicted peptide   gene model=Glyma11g10290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGFESYTPCSVHLPFHPIPSPSTSSLNTTTASLPFASRSRSGSPWSRSVLCEKMRCLLKLMPWEKKMDQATLLEENYKYVKFLQAQSRVLHSIPTPQALQVLENSLVAQTMWGFSYLEITISQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo