SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g09660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g09660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g09660

Feature Type:gene_model
Chromosome:Gm11
Start:6883512
stop:6888031
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68000AT Annotation by Michelle Graham. TAIR10: phosphatidylinositol synthase 1 | chr1:25491346-25492930 FORWARD LENGTH=227 SoyBaseE_val: 3.00E-128ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0008654GO-bp Annotation by Michelle Graham. GO Biological Process: phospholipid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003881GO-mf Annotation by Michelle Graham. GO Molecular Function: CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity SoyBaseN/AISS
GO:0016780GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, for other substituted phosphate groups SoyBaseN/AISS
KOG3240 KOG Phosphatidylinositol synthase JGI ISS
PTHR15362Panther PHOSPHATIDYLINOSITOL SYNTHASE JGI ISS
PTHR15362:SF2Panther gb def: phosphatidylinositol synthase [toxoplasma gondii] JGI ISS
PF01066PFAM CDP-alcohol phosphatidyltransferase JGI ISS
UniRef100_G7JMC6UniRef Annotation by Michelle Graham. Most informative UniRef hit: CDP-diacylglycerol-inositol 3-phosphatidyltransferase n=1 Tax=Medicago truncatula RepID=G7JMC6_MEDTR SoyBaseE_val: 5.00E-146ISS
UniRef100_I1LIG9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIG9_SOYBN SoyBaseE_val: 9.00E-165ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g09660 not represented in the dataset

Glyma11g09660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g03740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g091200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g09660.1   sequence type=CDS   gene model=Glyma11g09660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAGAAACCAGGACCAAGATCCAGTAAATTGTCAGTGTACCTTTACATTCCTAATATAATTGGATACATCCGGGTTCTTTTAAACTGTTTTGCCTTCTCCCAATGTTTATCAAACAAAATCTTATTCTCTATTCTGTATTTTTTAAGCTTTGTATGTGATGCTGTTGATGGCTGGTGTGCCCGCAAATTTAATCAAGTGTCAACCTTTGGAGCTGTGCTGGACATGGTAACAGACAGAATTAGCACTGCTTGTCTACTTGTAGTCCTTTCCCAACTGTACAAGCCTGGCCTTAGCTTCTTGTCATTGCTCGCTTTAGATATTGCCAGCCACTGGCTGCAAATGTACAGCACTTTCTTGACGGGAAAGACTAGTCATAAAGATGTAAAAGACAGCAGCAGCTGGCTTTTCAGGGCATACTATGGAAATAGGATGTTTATGGCTTACTGCTGTGTCTCATGTGAGGTTCTTTACTTAATCCTGTTTTATCTTGCCGAGAATCAAACAGAGAAACTGGTAGACGTTATATCAAGTAATTTACAAAAGATATCATTCCTTTCTCTTCTAATGGGTACTAGTTTATTTGGATGGGCAGTCAAGCAAATTATAAATGTTATCCAGATGAAGACAGCAGCAGATGCGTGTGTGCTTTATGACATCGAAAAAGAACACAAGAACTGA

>Glyma11g09660.1   sequence type=predicted peptide   gene model=Glyma11g09660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKKPGPRSSKLSVYLYIPNIIGYIRVLLNCFAFSQCLSNKILFSILYFLSFVCDAVDGWCARKFNQVSTFGAVLDMVTDRISTACLLVVLSQLYKPGLSFLSLLALDIASHWLQMYSTFLTGKTSHKDVKDSSSWLFRAYYGNRMFMAYCCVSCEVLYLILFYLAENQTEKLVDVISSNLQKISFLSLLMGTSLFGWAVKQIINVIQMKTAADACVLYDIEKEHKN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo