Glyma11g09660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g09660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g09660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g09660

Feature Type:	gene_model
Chromosome:	Gm11
Start:	6883512
stop:	6888031
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g09660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G68000	AT	Annotation by Michelle Graham. TAIR10: phosphatidylinositol synthase 1 \| chr1:25491346-25492930 FORWARD LENGTH=227	SoyBase	E_val: 3.00E-128	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0008654	GO-bp	Annotation by Michelle Graham. GO Biological Process: phospholipid biosynthetic process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003881	GO-mf	Annotation by Michelle Graham. GO Molecular Function: CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity	SoyBase	N/A	ISS
GO:0016780	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, for other substituted phosphate groups	SoyBase	N/A	ISS
KOG3240	KOG	Phosphatidylinositol synthase	JGI		ISS
PTHR15362	Panther	PHOSPHATIDYLINOSITOL SYNTHASE	JGI		ISS
PTHR15362:SF2	Panther	gb def: phosphatidylinositol synthase [toxoplasma gondii]	JGI		ISS
PF01066	PFAM	CDP-alcohol phosphatidyltransferase	JGI		ISS
UniRef100_G7JMC6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CDP-diacylglycerol-inositol 3-phosphatidyltransferase n=1 Tax=Medicago truncatula RepID=G7JMC6_MEDTR	SoyBase	E_val: 5.00E-146	ISS
UniRef100_I1LIG9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIG9_SOYBN	SoyBase	E_val: 9.00E-165	ISS

Expression Patterns of Glyma11g09660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g09660 not represented in the dataset	Glyma11g09660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g09660

Paralog	Evidence	Comments
Glyma12g03740	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g09660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g091200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g09660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g09660

Limit To All Plant Sequences

>Glyma11g09660.1   sequence type=CDS   gene model=Glyma11g09660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAGAAACCAGGACCAAGATCCAGTAAATTGTCAGTGTACCTTTACATTCCTAATATAATTGGATACATCCGGGTTCTTTTAAACTGTTTTGCCTTCTCCCAATGTTTATCAAACAAAATCTTATTCTCTATTCTGTATTTTTTAAGCTTTGTATGTGATGCTGTTGATGGCTGGTGTGCCCGCAAATTTAATCAAGTGTCAACCTTTGGAGCTGTGCTGGACATGGTAACAGACAGAATTAGCACTGCTTGTCTACTTGTAGTCCTTTCCCAACTGTACAAGCCTGGCCTTAGCTTCTTGTCATTGCTCGCTTTAGATATTGCCAGCCACTGGCTGCAAATGTACAGCACTTTCTTGACGGGAAAGACTAGTCATAAAGATGTAAAAGACAGCAGCAGCTGGCTTTTCAGGGCATACTATGGAAATAGGATGTTTATGGCTTACTGCTGTGTCTCATGTGAGGTTCTTTACTTAATCCTGTTTTATCTTGCCGAGAATCAAACAGAGAAACTGGTAGACGTTATATCAAGTAATTTACAAAAGATATCATTCCTTTCTCTTCTAATGGGTACTAGTTTATTTGGATGGGCAGTCAAGCAAATTATAAATGTTATCCAGATGAAGACAGCAGCAGATGCGTGTGTGCTTTATGACATCGAAAAAGAACACAAGAACTGA

Predicted protein sequences of Glyma11g09660

Limit To All Plant Sequences

>Glyma11g09660.1   sequence type=predicted peptide   gene model=Glyma11g09660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKKPGPRSSKLSVYLYIPNIIGYIRVLLNCFAFSQCLSNKILFSILYFLSFVCDAVDGWCARKFNQVSTFGAVLDMVTDRISTACLLVVLSQLYKPGLSFLSLLALDIASHWLQMYSTFLTGKTSHKDVKDSSSWLFRAYYGNRMFMAYCCVSCEVLYLILFYLAENQTEKLVDVISSNLQKISFLSLLMGTSLFGWAVKQIINVIQMKTAADACVLYDIEKEHKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain