SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g09590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g09590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g09590

Feature Type:gene_model
Chromosome:Gm11
Start:6850130
stop:6851563
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g09590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G31760AT Annotation by Michelle Graham. TAIR10: SWIB/MDM2 domain superfamily protein | chr1:11372602-11373414 REVERSE LENGTH=112 SoyBaseE_val: 7.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02201PFAM SWIB/MDM2 domain JGI ISS
UniRef100_D7KGM1UniRef Annotation by Michelle Graham. Most informative UniRef hit: SWIB complex BAF60b domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KGM1_ARALL SoyBaseE_val: 2.00E-07ISS
UniRef100_I1LIG0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIG0_SOYBN SoyBaseE_val: 4.00E-89ISS

Expression Patterns of Glyma11g09590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g09590 not represented in the dataset
Glyma11g09590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g09590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g090500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g09590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g09590
>Glyma11g09590.1   sequence type=CDS   gene model=Glyma11g09590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCGTTTGGTCGGAGAAGCATGTCCACTGTGGCGAAAGCGGTGGAGGAAATCACCGGCACTGGCAACACCAAGATCCGCAAATCTTCCAGCGAGCTCTGCACCTTCCTCGGCATCCCTCGCCAATCTCGTTCCGAAATCGCTCTCATTCTCTCCAAGTTCATCAAACTCTATAATTTCAAGAGTCCCGGCATTAAGAAGGACAAGATTTGGGAGCAGAATTTGCAGACACTGTTGCGTGGCAGAAACAATGTTGGTTTTCCTGAGATTGCGAAGATACTGTCTCCGGAATTCGGTCATGGCGCGATTAATGTGAAGGACAGTAGTATTGGGGATTCTTCCGGGGACGCCACCAAGGGGAAAGGCCCTAAAAAAAAAGGGAAGTCCTCTAAGAAGTAG
Predicted protein sequences of Glyma11g09590
>Glyma11g09590.1   sequence type=predicted peptide   gene model=Glyma11g09590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSFGRRSMSTVAKAVEEITGTGNTKIRKSSSELCTFLGIPRQSRSEIALILSKFIKLYNFKSPGIKKDKIWEQNLQTLLRGRNNVGFPEIAKILSPEFGHGAINVKDSSIGDSSGDATKGKGPKKKGKSSKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo