SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g09156): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g09156): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g09156

Feature Type:gene_model
Chromosome:Gm11
Start:6477167
stop:6477502
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35520AT Annotation by Michelle Graham. TAIR10: MUTL protein homolog 3 | chr4:16865488-16871527 FORWARD LENGTH=1169 SoyBaseE_val: 1.00E-26ISS
GO:0006200GO-bp Annotation by Michelle Graham. GO Biological Process: ATP catabolic process SoyBaseN/AISS
GO:0006298GO-bp Annotation by Michelle Graham. GO Biological Process: mismatch repair SoyBaseN/AISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009691GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0000795GO-cc Annotation by Michelle Graham. GO Cellular Compartment: synaptonemal complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005694GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chromosome SoyBaseN/AISS
GO:0005712GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chiasma SoyBaseN/AISS
GO:0032390GO-cc Annotation by Michelle Graham. GO Cellular Compartment: MutLbeta complex SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0030983GO-mf Annotation by Michelle Graham. GO Molecular Function: mismatched DNA binding SoyBaseN/AISS
PTHR10073Panther DNA MISMATCH REPAIR PROTEIN (MLH, PMS, MUTL) JGI ISS
PTHR10073:SF7Panther MUTL/HEXB FAMILY DNA MISMATCH REPAIR PROTEIN JGI ISS
UniRef100_G7K187UniRef Annotation by Michelle Graham. Most informative UniRef hit: MutL DNA mismatch repair protein n=1 Tax=Medicago truncatula RepID=G7K187_MEDTR SoyBaseE_val: 4.00E-35ISS
UniRef100_I1LIB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LIB6_SOYBN SoyBaseE_val: 3.00E-50ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g09156 not represented in the dataset

Glyma11g09156 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g09156.1   sequence type=CDS   gene model=Glyma11g09156   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGGGGACTCATTGCTACCATCAGAATGCTCCTTTATAGTTGAAGAGCTAAAACATACATCGCTTTGTTTCCAATGTGCTCATGGGCGACCAGCAACTGTTCCTCTAGTCAACTTGGAGGCACTGCATAATCAGATAGCCAAGCTTCGACTGATGAATGAGTGTTCAAGTGACGAGTGCCATGGATTACGTAGACATACAGTACGCGTTGAACGTGCAGCACAGCGTTTAAATTCTGCTAGAGGAATTTGA

>Glyma11g09156.1   sequence type=predicted peptide   gene model=Glyma11g09156   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFGDSLLPSECSFIVEELKHTSLCFQCAHGRPATVPLVNLEALHNQIAKLRLMNECSSDECHGLRRHTVRVERAAQRLNSARGI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo